SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067897 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067897
Domain Number 1 Region: 95-377
Classification Level Classification E-value
Superfamily L domain-like 1.9e-49
Family Ngr ectodomain-like 0.0064
Further Details:      
 
Domain Number 2 Region: 394-696
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 9.15e-43
Family Rhodopsin-like 0.00034
Further Details:      
 
Domain Number 3 Region: 25-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067897   Gene: ENSMUSG00000053368   Transcript: ENSMUST00000065745
Sequence length 737
Comment pep:known chromosome:NCBIM37:5:150821250:150883911:1 gene:ENSMUSG00000053368 transcript:ENSMUST00000065745
Sequence
MWLLLHVILLTEVKDFALADSSMVAPLCPKGYFPCGNLTKCLPRAFHCDGVDDCGNGADE
DNCGDTSGWTTIFGTVHGNVNKVTLTQECFLSQYPQHCYCRENELECVKADLKAVPKVSS
NVTLLSLKKNKIHRLPVKVFSRYTELRKIYLQHNCITHISRRAFLGLHNLQILYLSHNCI
TSLRPGIFKDLHQLAWLILDDNPITRISQKSFMGLNSLFFLSMVGNRLEALPETLCAQMP
QLNWVDLANNGIKYITNSTFLTCDSLTVLFLPRNQIGFVPEKTFSSLKNLGELDLSSNMI
TKLPVHLFSDLHLLQKLNLSSNPLLYVHKNQFGSLKQLQSLDLERIEIPNISTGMFQPMK
NLSHIYLKTFRYCSYVPHVRICMPSTDGISSSEDLLANGILRVSVWVIAFITCVGNFLVI
AVRSLIKAENTTHAMSIKILCCADCLMGVYLFSVGVFDIKYRGQYQKYALLWMESVPCRL
LGFLATLSTEVSVLLLTFLTLEKFLVIVFPFSNLRLGKRQTAVALASIWVVGFLIAAVPF
TREDYFGNFYGKNGVCFPLHYDQAEDFGSRGYSLGIFLGVNLLAFLVIVISYVTMFCSIH
KTALQTAEVRSHIGKEVAVANRFFFIVFSDAICWIPVFVVKILSLLQVEIPGTITSWIVV
FFLPVNSALNPILYTLTTSFFKDKLKQLLHKHRRKPIFKVKKKSLSASIVWTDESSLKLG
VLSKIALGDSIMKPVSP
Download sequence
Identical sequences Q91ZZ5
ENSMUSP00000067897 10090.ENSMUSP00000067897 ENSMUSP00000067897 NP_536716.2.92730 ENSMUSP00000067897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]