SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000068471 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000068471
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000759
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000068471   Gene: ENSMUSG00000024544   Transcript: ENSMUST00000063775
Sequence length 306
Comment pep:known chromosome:NCBIM37:18:68092911:68415203:1 gene:ENSMUSG00000024544 transcript:ENSMUST00000063775
Sequence
MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFN
SELEFAQILIIVVVVTVMVVVVVCLLNHYKVSTRSFINRPNQSQRQEDGLQPEGSLWPSD
SSVQRPGASEIMCAPRGRDRFTTPSFIQRDPFSRFQPTYPYVQHEIDLPPTISLSDGEEP
PPYQGPCTLQLRDPEQQMELNRESVRAPPNRTVFDSDLIDISMYNGGPCPPSSHSGISAA
TCSSNGRMEGPPPTYSEVMGHYPGTSFFHHQHSNTHRGSRPQFQPNNSEGTIVPIKGKDR
KPGDLV
Download sequence
Identical sequences Q4VAH9 Q8BWJ4
ENSMUSP00000068471 NP_766219.2.92730 XP_006526148.1.92730 XP_006526149.1.92730 XP_006526150.1.92730 XP_006526151.1.92730 XP_006526152.1.92730 ENSMUSP00000068471 10090.ENSMUSP00000068471 ENSMUSP00000068471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]