SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069080 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069080
Domain Number 1 Region: 26-532
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-122
Family L-arabinose binding protein-like 0.00000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069080   Gene: ENSMUSG00000051980   Transcript: ENSMUST00000063597
Sequence length 1079
Comment pep:known chromosome:NCBIM37:16:36493783:36562220:-1 gene:ENSMUSG00000051980 transcript:ENSMUST00000063597
Sequence
MAWFGYCLALLALTWHSSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQQVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIWLASEAWA
SSSLIAMPEYFHVVGGTIGFGLKAGQIPGFREFLQKVHPRKSVHNGFAKEFWEETFNCHL
QDGAKGPLPVDTFVRSHEEGGNRLLNSSTAFRPLCTGDENINSVETPYMDYEHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEGKILWSGFSREVPFS
NCSRDCQAGTRKGIIEGEPTCCFECVECPDGEYSGETDASACDKCPDDFWSNENHTSCIA
KEIEFLAWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICIIWLYTAPPSSYRNHELEDEIIFITCHEGSLMALGSLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKVYIILFKPSRNTIEEVRSSTAAHAFKVAARATLRRPNISRKRSS
SLGGSTGSIPSSSISSKSNSEDRFPQPERQKQQQPLALTQQEQQQQPLTLQPQQQQQPQQ
PRCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSMRQNSLEAQKSNDTLNRHQALLPLQCA
EADSEMTIQETGLQGPMVGDHQPEIESPDEMSPALVMSTSRSFVISGGGSSVTENILHS
Download sequence
Identical sequences Q9QY96
ENSMUSP00000110496 ENSMUSP00000069080 NP_038831.2.92730 XP_006521792.1.92730 XP_006521793.1.92730 XP_006521794.1.92730 XP_006521795.1.92730 ENSMUSP00000069080 ENSMUSP00000133500 10090.ENSMUSP00000069080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]