SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069647 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069647
Domain Number 1 Region: 51-474
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-94
Family L-arabinose binding protein-like 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000069647
Domain Number - Region: 496-543
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0165
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 591-799
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0418
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069647   Gene: ENSMUSG00000053720   Transcript: ENSMUST00000066317
Sequence length 845
Comment pep:known chromosome:NCBIM37:7:9866727:9882979:1 gene:ENSMUSG00000053720 transcript:ENSMUST00000066317
Sequence
MLTLMGVFFFLNIPLFMANFIDPRCFWRINLNEIQDEYLGLTCAFILAAVQKPIEKDYFN
KTLNFLKTTKNHKYALALVFSMDEINRNPDLLPNMSLIIRYTLGRCDGKTGIPTPYLLHK
KKQSPIPNYFCNEESMCSFLLTGPNWEILQLTYGPFHSTFSDDEQYPYLYQMAPKDTSLA
LAMVSFIHYFNWNWIGLLIPDDDQGNQFLLELKKQSGNKKICFAFVKMISVDDILLEQKT
EMYYQQIVMSSSNVIIIYEETINFIDLIFRMWEPPVLRRIWITTKQWNFPTSKRDITHGT
FYGSLTFLPHRGGISGFKNFVQTWFHLRSKDLYLVMPEWKYFKYESLASNCKMLKSNSSN
ASFDWLMEQKFDMAFSESSHNIYNAVYVVAHALHEMNLQQVDNQAVDNGKGASSHCLKVN
SFLRKIHFTNPVGDKVIMKQRVIMQEDYDIFHFENLSQHLGIKVKLGKFSPYFSHGRNFH
LYVDMLEVATGSRKMPSSVCSAECSPGFRRLWKEGMAACCFVCRPCPENEISNETNMDQC
VNCPEYQYANTEQNKCIKKGVTFLSYEDPLGMVLALMAFCFSAFTAVVLCVFVKHHDTPI
VKANNRILSYILLLSLMSCFLCSFFFIGHPNRATCVLQQITFGIVFTVAVSTVLAKTVTV
VLAFKVTDPGRRLRHFLVSGTPNYIIPICSLFQCVLCAIWLAVSPPFVDIDEHSQHGHII
IVCNKGSVTAFYCVLGYLACLALGSFIVAFLAKNLPDTFNEAKFLTFSMLVFFSVWVTFL
PVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKIYIILMRPERNSTQNIKESNSTQKIK
EKSNS
Download sequence
Identical sequences Q80Z08
ENSMUSP00000069647 ENSMUSP00000069647 ENSMUSP00000069647 NP_945199.1.92730 10090.ENSMUSP00000069647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]