SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071670 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071670
Domain Number 1 Region: 64-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.02e-104
Family L-arabinose binding protein-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071670   Gene: ENSMUSG00000072049   Transcript: ENSMUST00000071760
Sequence length 849
Comment pep:known chromosome:NCBIM37:X:121241387:121249519:-1 gene:ENSMUSG00000072049 transcript:ENSMUST00000071760
Sequence
MKKLCAFTISFLFLKFSLILCCLSEPSCFWRIRNSEDSDGDLQRECHFYLWLIDESIEDN
FVSDLNFRIAASEYELLLVIFFATDEINKNSYLLPNMTLMFSIIGGNCHDLLRSLDQEYT
EIKGHMNFVNYFCYLDDSCAIGFTGPSWKTSLKLGLHSSMPLVFFGPFNPNLRDHDRLPH
VHQVATKDTHLSHGMVSLMFHFRWTWIGLVISDDDQGIQFLSDLREESQRHEICLAFVNM
IPENMQIYMTRATIYDKQIMTSSANVVIIYGEMNSTLEVSFRRWEELGAWRIWITTSQWD
VIKNKKEFTFNLFHGTITFAHHKVEIPKFKKFMQTMNTAKYPVDISHTILEWNYFNCSIS
KNSSKMDHMTFNNTLEWTALHNYDMAMSDEGYNLYNAVYAAAHTYHEHILQQVESQKKAK
PKRYFTACQQVSSLMKTRVFSNPVGELVNMKHRENQCTEYDIFIIWNFPQGLGLKVKIGS
YIPCFPKSQQLHICDDLEWAMGGTVEQVPSSVCSVACTAGFRKIHQEETADCCFDCVQCP
ENEVSNETDMEQCVRCPDDKYANIEQTHCLSRAVSFLAYEDPLGMALGCMALSFSAITIL
VLVTFVKYKDTPIVKANNRILSYILLISLVFCFLCSLLFIGHPNQVSCILQQTIFGVFFT
VSVSTVLAKTITVVMAFKLTTPGRRIRGMMMTGAPKLVIPICTLIQLVLCGIWLVTSPPF
IDRDIQSEHGKTVILCNKGSVIAFHVVLGYLGSLALGSFTLAFLARNLPDTFNEAKFLTF
SMLVFCSVWITFLPVYHSTRGRVMVVVEVFSILASSAGLLMCIFVPKCYVILIRPDSNFI
KKHKGKLLN
Download sequence
Identical sequences ENSMUSP00000071670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]