SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074613 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074613
Domain Number 1 Region: 51-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.39e-100
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000074613
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0129
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0497
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074613   Gene: ENSMUSG00000071459   Transcript: ENSMUST00000075108
Sequence length 861
Comment pep:known chromosome:NCBIM37:7:7336696:7352338:-1 gene:ENSMUSG00000071459 transcript:ENSMUST00000075108
Sequence
MFTLMGVFFFLNIPLFMANFIDPRCFWRINLNEIQDEYLGLTCAFILAAVQKPIEKDYFN
KTLNFLKTTKNHKYALALAFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFHK
KKQSPIPNYFCNEETMCSFLLTGPNWGVSISFWKYLDSFLSPRILQLTYGPFSSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFNWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDISFEHKTEMYYKQIVMSSSNVIIIYEETINFIDLIFRMWEPPVLQRIWITT
KQWNFPTSKRDITHGTFYGSLTFLPHHGGISGFKDFVQTWFHLRSKDLYLVMPEWKYFKY
ESSASKCKILKNNSSDASFDWLMEQKFDMAFSESSHNIYNAVHAIAHALHEVNLQQVDNQ
AIDNGKGASSHCLKVNSFLRKIHFTNPLGDKVIMKQRVIMQEEYDIFHFGNLSQHLGIKV
KLGKFSPYFSHGRNFHLYVDMLEVATGSRKMPSSVCSAECSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRILSYLLLISLMSCFLCSFFYIGHPNRATCVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWIEVS
PPFVDIDEHSQHGHIIIVCNKGSVTAFYCVLGYLACLALGSFTLAFLAKNLPDTFNEAKF
LTFSMLVFFSVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKIYIILMRPER
NSTQKIKVRNSTQKIKEKSYF
Download sequence
Identical sequences L7N1Z4
ENSMUSP00000074613 ENSMUSP00000074613 ENSMUSP00000074613 NP_001098532.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]