SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075687 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075687
Domain Number 1 Region: 417-531,653-799
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.97e-64
Family Phosphate binding protein-like 0.00000000195
Further Details:      
 
Domain Number 2 Region: 23-402
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.89e-54
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 555-650
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000746
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075687   Gene: ENSMUSG00000001986   Transcript: ENSMUST00000076349
Sequence length 888
Comment pep:known chromosome:NCBIM37:X:38754481:39031778:1 gene:ENSMUSG00000001986 transcript:ENSMUST00000076349
Sequence
MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTE
KPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVT
PSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTERGFSILQAIMEAAVQNNW
QVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYM
LANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYT
SALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGM
TGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSSSSENRTIV
VTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPE
TKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFS
FLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIF
NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIE
SAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVR
KSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLS
EQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEF
CYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences Q9Z2W9
ENSMUSP00000075687 XP_006541583.1.92730 XP_017174034.1.92730 ENSMUSP00000110755 ENSMUSP00000075687 10090.ENSMUSP00000075687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]