SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075833 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075833
Domain Number 1 Region: 52-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-96
Family L-arabinose binding protein-like 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000075833
Domain Number - Region: 512-550
Classification Level Classification E-value
Superfamily TNF receptor-like 0.01
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075833   Gene: ENSMUSG00000070841   Transcript: ENSMUST00000076515
Sequence length 802
Comment pep:known chromosome:NCBIM37:7:7623988:7642224:-1 gene:ENSMUSG00000070841 transcript:ENSMUST00000076515
Sequence
MFIFMEVFFLLNITLLMANFIDPRCFWRINLDEIMDEYLGLSCAFILAAVQTPIENDYFN
KTLNVLKTTKNHKYALALVFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFRK
KKESPIPNYFCNEETMCSYLLTGPHWEVSLGFWKHMNSFLSPRILQLTYGPFHSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFSWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDVSFPQNTEMYYNQIVMSSTNVIIIYGETYNFIDLIFRMWEPPILQRIWITT
KQLNFPTRKTDISHGTFYGSLTFLPHHGVISGFKNFVQTWFHLRNTDLYLVMQDWKYFNY
EDSASTCKILKNNSSNASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIDNGKGASSHCLKVNSFLRRIYFTNPPGDKVFMKQRVIMQDEYDIVHFVNLSQHLGIKM
KLGKFSPYLPHGRHSHLYVDRIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETTVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMSCFLCSFLFIGLPNRAI
CVLQQITFGIVFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQC
VLCAIWLAVSPPFVDIDEHTLHGHIIIVCNKGSVTAFYCILGYLACLALGNFSVAFLAKN
LPDTFNEAKFLTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGILGCIFVPK
IYIILMRPERNSTQKIREKSYF
Download sequence
Identical sequences ENSMUSP00000075833 XP_017177380.1.92730 10090.ENSMUSP00000075833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]