SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000076687 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000076687
Domain Number 1 Region: 45-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.51e-98
Family L-arabinose binding protein-like 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000076687
Domain Number - Region: 508-554
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0259
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000076687   Gene: ENSMUSG00000070458   Transcript: ENSMUST00000077478
Sequence length 851
Comment pep:known chromosome:NCBIM37:7:93006057:93024448:-1 gene:ENSMUSG00000070458 transcript:ENSMUST00000077478
Sequence
MFSLIFIFWFLKISYIFCHLSNPRCFWRIKDTKDKLGDKETYCFFSISAKHGYIRNDYFS
WNLDKHVTPKTNHLIFSVYLALEEINKNSHILPNISLVVNIECVLLKYGEKTGLGLKHEE
FIPNYYCANERRYLIVLTAPIWAVSTKLGPFLFMSRIPELYCGHFHLPLSDNEQFPHLYQ
ISPKDTSLPLAMVSLVVHFRWNWIGVIITNDNHGIQFLSELRGETQKQIVCLSVVIIIQT
DDITAYKEYHMNYNKIVMSSAKVVIVYGDHNSPIKFVLFLWKSQGIFRIWVSVSQFDMIT
PLGDFMLYSASGTLIFSHQQSELSGFEKFIKTVKPSNYSSEFSFAKLWWTYFRCSSLPPS
NCKKLKNCPTKTVFRWLFMTPLGMAMSDTCYNLYNAIYAVAHSLHEMLLQQVDTWSENAG
KELEFDSWKMFSILKTMQFVNPAGDLVNMNQNLKQEREYDIFYIMDFQKDYGLKMKIGKF
SGHLPSHQQLYMSKEMIEWATDMDQILPSICSMPCRPGLRKSPQEGKDICCFVCNPCPEN
EISNMTNMDQCVKCPEDQYANEDHTLCLQKIVAILDYRDPLGKALAGFALCFCVITSGVL
CIFLKHRETPIVKANNQTLSYVLLISLIFCFICSLLYIGHPTIVICVLQQSTFAISFTVA
ASTILAKTITVVLAFKVTVPGRMRWLLVAGAPKYIILICTMIQLILCGVWLGTSPPFVDA
DLHMVHGHIIIVCNKGSVIAFYFVLGYMGSIALASFTVAFLARNLPDTFNEAKLLTFSML
VFCSVWVTFIPVYYSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYNILLRPGKNSSHMF
KKLHAKTENII
Download sequence
Identical sequences D3Z7M3
NP_001098656.1.92730 ENSMUSP00000076687 ENSMUSP00000076687 ENSMUSP00000076687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]