SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077611 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077611
Domain Number 1 Region: 101-384
Classification Level Classification E-value
Superfamily L domain-like 1.19e-50
Family Ngr ectodomain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 404-708
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.65e-46
Family Rhodopsin-like 0.00069
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077611   Gene: ENSMUSG00000034009   Transcript: ENSMUST00000078527
Sequence length 758
Comment pep:known chromosome:NCBIM37:3:79448638:79541716:-1 gene:ENSMUSG00000034009 transcript:ENSMUST00000078527
Sequence
MTSGPFFFCIFIIGKYFTLGSAQDVSCPLGSFPCGNMSRCLPQLLHCNGVDDCGNRADED
HCGDNNGWSLQLDKYFANYYKLASTNSFEAETSECLVGSVPMHCLCRDLELDCDEANLRA
VPSVSSNVTVMSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLRSLTKLY
LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK
PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFTHLQKLDEL
DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLEGIEISNIQQ
RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC
FGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYLFVIGAFDLKFRGEYNKHAQPWM
ESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTITVLIFIWIIGF
IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG
SMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPDS
ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWHNYRQRRSVDRKETQKAYAPSFIW
VEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSRLNSYS
Download sequence
Identical sequences Q6R6I7
ENSMUSP00000077611 ENSMUSP00000077611 10090.ENSMUSP00000077611 NP_997617.1.92730 ENSMUSP00000077611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]