SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078200 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078200
Domain Number 1 Region: 35-502
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.14e-111
Family L-arabinose binding protein-like 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000078200
Domain Number - Region: 510-569,632-649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000746
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078200   Gene: ENSMUSG00000079698   Transcript: ENSMUST00000079206
Sequence length 857
Comment pep:known chromosome:NCBIM37:17:18435245:18463405:1 gene:ENSMUSG00000079698 transcript:ENSMUST00000079206
Sequence
MFSWIFIFWLLQIPKLVSAFTFKISRCYYIITEEFHHEGDFMIGAFFPLHTFYTEKKMPH
STIPYTYLDGYVQYNFKNYQYILALQFAIEEINGNPNLLPNISLGFDFYNVRFTEKDTLM
NAGIWLTSHVHKMVFPNYTCGKKKFTAALTGSSWMASAQIGTLLHLFKFPQITFGPYDPL
LSDHSQYSSLYQMAPQDTSLTLAIVSLIVHFRWLWVGLILPDDHKGNKILSDFREEMERK
RICMAFVKMIPATWTSYFAKFWKNMDETNVIIIYGDIDSLEGLMRNIGQRLLTWIVWVMN
TEHHVLEISDYFMLDSFHGSLIFKHHYRENSDFTKFIQTVNPKNYPEDIYLPKLWYYFFK
CSFSDINCHVLDNCQTNASLDVLPSHIFDVAMTEESTSIYNGVYALAHSLHEMRLQQLQV
QPFENGEGMVFFPWQLNTFLKDIEMRKNRSLYWRQTIDVEYDILNLWNLPKGLGLKVKVG
SFSANAPQGQQLSLSEQMIQWPAIFSEIPQSVCSESCQSGFRKVSQEGKAICCYNCTPCA
ENEISNETDVDQCVKCPESHYANTERNNCLQKSVSFLAYDEPLGMALASIALCLSTITVF
VIGIFLRHRDTPIVKANNQGLSFILLITLTFCFLCSLNFIGQPNTSACILQQTTFAVAFT
MALATVLAKAITVVLAFKVSFPGRMVRWLMISRGPNYIIPICTLIQLLLCGIWMATYPPF
IDQDAHTEHGHIILLCNKGSAVAFHSVLGYLCFLALGSYTMAFLSRNLPDTFNESKFLSF
SMLVFFCVWVTFLPVYHSTNGKVLVAMEVFSILASSSALLAFIFGPKCYIILLRPDKNSF
NHIRRKQHTRRKNSPKI
Download sequence
Identical sequences L7N1Z9
NP_001098012.1.92730 ENSMUSP00000078200 ENSMUSP00000078200 ENSMUSP00000078200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]