SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079827 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079827
Domain Number 1 Region: 51-493
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.31e-94
Family L-arabinose binding protein-like 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000079827
Domain Number - Region: 512-551
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00247
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079827   Gene: ENSMUSG00000070850   Transcript: ENSMUST00000068935
Sequence length 553
Comment pep:known chromosome:NCBIM37:7:10092187:10112228:1 gene:ENSMUSG00000070850 transcript:ENSMUST00000068935
Sequence
MFIFMGVFFLLNITLLMANFIDPRCFWRINLDEITDEYLGLSCTFILAAVQTPTEKDYFN
KTLNVLKTTKNHKYALALVFAMDEINRNPDLLPNMSLIIRYTLGLCDGKTVTPTPYLFHK
KKQSPIPNYFCNEETMCSFQLSGPKWDVSLSFWMYLDSFLSLRILQLTYGPFHSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYLKWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDTSFPHKTEMDYNQIVMSSTNVIIIYGETRNFIYLIFRMWEPPILQRIWITT
KQLNFPTRKTDISHGTFYGSLTFLPHHGEISGFKKFVQTWFHVRNTDLYLVMPEWNYFNY
VSSASNCKILKNNSSDASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIGNGKGASSHCLKVNSFLRRTCFTNPLGDKVFMKQRVIMQDEYDIIHFGNLSQHLGIKM
KLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETNM
Download sequence
Identical sequences ENSMUSP00000079827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]