SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083386 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083386
Domain Number 1 Region: 2-419
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.89e-101
Family L-arabinose binding protein-like 0.0000302
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000083386
Domain Number - Region: 441-489
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0235
Family TNF receptor-like 0.012
Further Details:      
 
Domain Number - Region: 514-647
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0589
Family ABC transporter transmembrane region 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083386   Gene: ENSMUSG00000053088   Transcript: ENSMUST00000086210
Sequence length 806
Comment pep:known chromosome:NCBIM37:7:13200582:13221483:-1 gene:ENSMUSG00000053088 transcript:ENSMUST00000086210
Sequence
MWGYRVTQSFVFAIEEINRSAHLLPNLTLGFSIRNSGDSVHGALYETMGFLTGQKEPIPN
YTCQHGSPQAALVGDTRSSLSVSMARLLGLYKFPQVSYSSSLPSLSDKIQFPSFLRTLTS
DITSSHAVTQLIIHFQWSWVIILAQDDDFGQQASSLATQQLSPAGVCIEYHLHVPSYQSL
GKIEETVQKMQKCTAKVVLVFLSNLNFQLILRGLLGVPVSGQVWVSKGTLHMALALTIPG
ISQVLQGTFGLLYHSSRAIGFPEFLAHLRPSQTPEDMFIKKFWEFTFDCTWPYQNSTVTE
GVQFCTGNESLKNKPHPFPEVSKIDAAYTAVYSIAHALHNMLACEHQERKGTNSHNFHSW
QLLHALKKVHFKTLDGIKIMFDANGDLVTKFDIFQGQKTPAGVFHLVHVGMIDPQVSSGN
KMMVQLKEDLQVSSLNAEETVPTSICSESCLPGFSQVPRLGAPHCCFDCSPCPEGQFTDQ
RDMKRCLLCPKEQYSSHTRDHCLPRTEIFLAFEEPLGFVLALVALLLAGLAVLVLGVFLK
HRDTPVVRANNRTLSYFLLISLSLCALCALLFLGRPTVTTCLLRQTTFAVVFTVAVSSVL
AKTLTVVLAFRVTRPRSRIQICLSPGTSTFVVLIASLIQVVLCGVWLATSPPFPDKDMIS
EPQHIVIQCQEGSGATFFCVLGYLGFLAGGTFSVAFLARGLPDIFNETKFLTFSMLLFCS
VWTAFLPLYHSARGKSTVAVEIFSILASTAGLLGGIFIPKCYIILLKPEKNTPAWLKQGY
CAQQEKQGEMLQRRYKFSGESPEPNI
Download sequence
Identical sequences K7N649
ENSMUSP00000083386 ENSMUSP00000083386 ENSMUSP00000083386 NP_001074918.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]