SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090148 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090148
Domain Number 1 Region: 48-504
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.75e-111
Family L-arabinose binding protein-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000090148
Domain Number - Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000114
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 
Domain Number - Region: 510-574,637-651
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090148   Gene: ENSMUSG00000073445   Transcript: ENSMUST00000092491
Sequence length 857
Comment pep:known chromosome:NCBIM37:17:22684908:22710240:-1 gene:ENSMUSG00000073445 transcript:ENSMUST00000092491
Sequence
MFTLIFLFLLLNIPLLVADFIHPRCFWKMKRNENKDRNQGTGCTFVIHAVQQPVEKEYFS
HILNIQTQTENRKYALALAFSINEINRNPDLLPNMSLIFKFSAHNCVWESEIMNLMLLSL
QNYDIFPNYLCKEYTKCAMALTNLNWATTVTLYTILNNIISEQFLQITYGPFHPVLSDHE
KFPYLHQMASDHTSLALALVSFIIHFGWNWVGLVISDSDQGIQFLSYLRREMEKYTVCFA
FVNMIPVNMNLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITT
SQWDVSPRMKDFTFGNKYGTFDFQQHNSEISGFKNFVQTLNSVKYPDDYLVELEWMHFNC
EVSASKCKTLKNCSSNHSLEWLMVHTFDMAFIEKSYYIYNAVYAFAHALHQFTFQKFDNL
PKDNGKEHNYSCKKVDPSLRKMQFTNPVGDIVNMNQRDKLQEEYDIFYIWNFPQGLGLRV
KIGMFSPYLPNGQQVHLSEVIIKWTKGSTQVPTSVCSADCGPGSRKFGMDGMAACCFHCK
PCPENEISNETNVDNCAQCPEDQYANTEQNHCIHKAVVFLNYEEPLGMALSLFSLCFSAF
TTVILGVIVKHHNTPIVKANNRTLTYILLISLIFCFLCPLLFIGHPNSVTCILQQITFGV
VFTVALSTVLAKTIVVVLAFKITASQRMMKYFLVSGASNYIILICTLIQVIVCAVWLGAS
PPSVDIDAQSEHGHIIIVCHKGSVNAFYSILGYLALLSFGSFTLAFLSRNLPGAFNEAKS
ITFSMLVFCSVWVTFIPVYHSTKGKVMVAVEIFSTLASSAGMLGCIFVSKCYTILFRPDR
NSVEMTRVKSSFHARVS
Download sequence
Identical sequences D7URW2 K7N674
ENSMUSP00000090148 ENSMUSP00000090148 ENSMUSP00000090148 NP_001098043.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]