SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092079 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092079
Domain Number 1 Region: 55-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.74e-104
Family L-arabinose binding protein-like 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000092079
Domain Number - Region: 506-555
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0518
Family TNF receptor-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092079   Gene: ENSMUSG00000070601   Transcript: ENSMUST00000094502
Sequence length 849
Comment pep:known chromosome:NCBIM37:10:129822856:129831297:-1 gene:ENSMUSG00000070601 transcript:ENSMUST00000094502
Sequence
MKKMCALTISFLLLKFSLILCCLKEPICFWRIKSSEYNDGNLQSECGYFVWTMKKLMKDD
FYNVWLDFRIPASEYEFVLVMFFATNEINKNPDLLPNTSLVFSVMAGNCQDSLGNLDIQY
MLTNDSLNYVNYVCDIDDSCAIGLTGPSWKTSLKLAIDSWTPTVFFGPFNPKLSDHDHFP
YVHQIATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQGVQLHSDLREESQRHGICLAFVN
VIPETMKIYMTRGNMYDKQIMTSSAKVVIIYGEMNSTLEISFRRWAYLGARRIWITTSQW
DVITNKKDFSLDLFHGTVTFAHHKGWIAKFKNFMQTMNTSKYPINISQSVLRWNYFNCSV
SKNSIKMDHFTCENPLELTALHNYDMALSDEGYNLYNAVYAVAHTYHEHILQQVESQKMA
EDKGEYTECQQLAPLLKTRVFTNPVGEMVNMNHREYQCAEYDIFIIWNFPQGLGLKVKIG
SYFPCFPQSQQLHISEDLEWATGGTSVPSSMCSVTCTPGFRKIHQKETADCCFDCVQCPE
NEVSNETDMEQCVRCPDDQYANLEQTHCLQRAVSFLAYEDPLGMALGCMALSFTAITILV
LVTFVKYRDTPIVKANNCILSYILLISLVFCFLCSLLFIGHPNQVTCILQQTTFGLFFTV
AVSTVLAKTITVVMAFKLTTPGGRMRGMMMMTGAPKLVIPICTLIQLVLCGIWLLTSPPF
IDRDIQSEHGKTVIFCNTGSVLAFHVVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTF
SMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCIFVPKCYAILVRPDSNCI
QKYKGKLLY
Download sequence
Identical sequences D3YWE3
10090.ENSMUSP00000092079 ENSMUSP00000092079 ENSMUSP00000092079 ENSMUSP00000092079 NP_001074917.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]