SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092460 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092460
Domain Number 1 Region: 51-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-93
Family L-arabinose binding protein-like 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000092460
Domain Number - Region: 512-550
Classification Level Classification E-value
Superfamily TNF receptor-like 0.01
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092460   Gene: ENSMUSG00000070848   Transcript: ENSMUST00000094864
Sequence length 802
Comment pep:known chromosome:NCBIM37:7:8246140:8271350:1 gene:ENSMUSG00000070848 transcript:ENSMUST00000094864
Sequence
MFIFMGVFFLLNITLLMANFIDPRCFWRINLDEITDEYLGLSCTFILAAVQTPTEKDYFN
KTLNVLKTTKNHKYALALVFAMDEINRNPDLLPNMSLIIRYTLGLCDGKTVTPTPYLFHK
KKQSPIPNYFCNEETMCSFQLSGPKWDVSLSFWMYLDSFLSLRILQLTYGPFYSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYLKWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDTSFPHKTEMDYNQIVMSSTNVIIIYGETRNFIYLIFRMWEPPILQRIWITT
KQLNFPTRKTDISHGTFYGSLTFLPHHGEISGFKKFVQTWFHVRNTDLYLVMPEWNYFNY
VSSASNCKILKNNSSDASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIGNGKGASSHCLKVNSFLRRTCFTNPLGDKVFMKQRVIMQDEYDIIHFGNLSQHLGIKM
KLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETTVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMFCFLCSFFFIGLPNRAI
CVLQQITFGIVFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQC
VLCAIWLAVSPPFVDIDEHTLHGHIIIVCNKGSDTAFYCILGYLACMALGSFSLAFLAKN
LPDTFNEAKFLTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGILGCIFVPK
IYIIFMRPERNSTQKIREKSYF
Download sequence
Identical sequences ENSMUSP00000092460 XP_017167901.1.92730 XP_017177386.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]