SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092735 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092735
Domain Number 1 Region: 662-817
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-34
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 979-1143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-34
Family MAM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 67-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-33
Family MAM domain 0.0055
Further Details:      
 
Domain Number 4 Region: 820-977
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-29
Family MAM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 495-651
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-19
Family MAM domain 0.0056
Further Details:      
 
Domain Number 6 Region: 275-428
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-18
Family MAM domain 0.018
Further Details:      
 
Domain Number 7 Region: 229-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 457-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000733
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000092735
Domain Number - Region: 35-56
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00816
Family LDL receptor-like module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092735   Gene: ENSMUSG00000026941   Transcript: ENSMUST00000095117
Sequence length 1232
Comment pep:known chromosome:NCBIM37:2:25418635:25426836:-1 gene:ENSMUSG00000026941 transcript:ENSMUST00000095117
Sequence
MCLPSHLLSTWVLFMVTLPAAQSLGKTWLPNHCRSPIKAVCNFVCDCGDCSDETQCGFHG
ASTIPSTSFTCNFEQDSCGWQDISTSGYRWLRDRAGAVLHGPGPHSDHTHGTDLGWYMAV
GTHSGKEPSTATLRSPVMREAAPTCELRLWYHIASRDVAELRLDLTHGVETLTLWQTSGP
WGPGWQELAVNTGRIQGDFKVTFSATRNATHRGAVALDDVEFRDCGLPIPQARCPLGHHH
CQNKACVEPHQLCDGEDNCGDRSDEDPLICSHHMATDFETGLGPWNQLEGWTRNHSAGSM
VSPAWPHRDHSRNSAYGFFLISVAKPGTTAVLYSPEFQGSVSNNCSFTFYYYLHGSEASH
FQLFLQAQGLNTPQVPVLLRSRHGELGTAWVRDRVDIQSAHPFRILLAGETGPGGVVGLD
DLIMSSHCMLVPAMSTLQSSLSGPVPLALYPQTSIKLPQQTCEPGHLSCGDLCVPPEQLC
DFQKHCAEGEDEHKCGTTDFESASAGGWEDISVGKLQWQWVEAQEKSKPAGDANRDAPGH
FLSLQKAWGQLRSEARALTPALGPSGPHCELHMAYYFQSHPQGFLALVVVENGFRELLWQ
APGGGSGSWTEEKIILGARRRPFQLEFVSLVDLDGPGQQGAGVDNVTLRDCNPMVTTESD
QELSCNFERDSCSWHTGHLTDAHWHRIKSHGSQLDHTTGQGFFMFLDPTDPPARGQGALL
LTRPQVPVVPKECLSFWYRLYGPQIGTLCLAMRREREEDILLWSRSGTHGNRWHQAWVTL
HHQPEASTKYQLLFEGLRNGYHGTMALDDIAVRPGPCWAPKSCSFEDSDCGFSPGGWGLW
THQSNASGLASWGPWIDHTTGTAQGHYMVVDTSPNVLPKGHVAALTSEEHQPLSQPACLT
FWYHMSVPNPGTLRVHVEESTRRQELSISAHGRSAWRLGSVNVQAEQAWKVVFEAVAAGV
EYSYMALDDISLQDGPCPQPGSCDFETGLCGWSHLPWPSLGGYSWDWSSGATPSRYPQPS
VDHTLGTEAGHFAFFETSVLGPGGQAAWLRSEPLPATTVSCLRFWYYMGFPEHFYKGELR
VLLSSARGQLAVWYQGGHLRDQWLQVQIELSNSEEFQIVFEATLGGQPALGPIAIDDVQY
LAGQQCKQPSPSQGEVAAPVSVPVAVGGALLFFMFLVLMGLGGWHWLQKQHCPGQRSTDA
AASGFANILFNADHVTLPESITSNPQSPPDLA
Download sequence
Identical sequences D3YY20
ENSMUSP00000119789 NP_001074668.2.92730 ENSMUSP00000092735 ENSMUSP00000092735 10090.ENSMUSP00000092735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]