SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000094994 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000094994
Domain Number 1 Region: 52-504
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.36e-111
Family L-arabinose binding protein-like 0.0022
Further Details:      
 
Domain Number 2 Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000157
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000094994
Domain Number - Region: 514-574,637-651
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00131
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000094994   Gene: ENSMUSG00000073444   Transcript: ENSMUST00000097381
Sequence length 857
Comment pep:known chromosome:NCBIM37:17:22738115:22756100:1 gene:ENSMUSG00000073444 transcript:ENSMUST00000097381
Sequence
MFTLIFLFLLLNIPLHVADFIHPRCFWKMKRNENKDRNQGTECTFVIQAVQQPVEKEYFS
HILNIQTQTENRKYALALAFSINEINRNPDLLPNMSLIFKFSAENCVWENKLMSLMHSSL
QNYDILPNYLCEEYTECVMALTSLNWATTVTLYTILNNFMSEQFLQITYGPFHPVLSDHE
KFPYLHQMASDHTSLALALVSFIIHFGWNWVGLVISDSDQGIQFLSYLRREMEKYTVCFA
FVNMIPVNMNLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITT
SQWDVSPSMKDFTFGNKYGTFDFQQHNSEISGFKNFVQTLNSVKCPDEYLVELEWMHFNC
EVSASKCKPLKNCSSSYSFDWLMEHTFDMAFIEKSYYIYNAVYAFAHALHQFTFQKFDNL
PKDNGKKHNYSCKKVDSSLRKTQFTNPVGDIVNMNQKGELQEEYDIFYIWNFPQGLGLRI
KIGMFSPYFPNGQQVHLSEVMIRWAKGSTQVPTSVCSADCGPGSRKFEMDGMAACCFHCK
PCPENEISNETNVDNCVQCPEDQYANTEQNHCIHKAVVFLSYEEPLGMALSLLSLFFSAF
TTVILGVIVKHHNTPIVKANNRTLTYILLISLIFCFLCPLLFIGHPNSVTCFLQQITFGV
VFTVALSTVLAKTITVVLAFKITASQRMMKYFLVSGASNYIILICTLIQVIVCAVWLGAS
PPFVDIDAQSEHGHIIIVCHKGSVNAFYSILGYLALLSFGSFTLAFLSRNLPGAFNEAKS
ITFSMLVFCSVWVTFIPVYHSTKGKVMVAVEIFSTLASSAGILGCIFVSKCYTILFRPDR
NSVEMTRVKSSFHAHIS
Download sequence
Identical sequences D7URW1 L7N221
NP_001098045.1.92730 ENSMUSP00000094994 ENSMUSP00000094994 ENSMUSP00000094994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]