SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000094999 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000094999
Domain Number 1 Region: 66-124,187-204
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000628
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000094999
Domain Number - Region: 6-57
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000158
Family L-arabinose binding protein-like 0.026
Further Details:      
 
Domain Number - Region: 259-371
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0173
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000094999   Gene: ENSMUSG00000067978   Transcript: ENSMUST00000097386
Sequence length 409
Comment pep:known chromosome:NCBIM37:17:18201001:18211184:1 gene:ENSMUSG00000067978 transcript:ENSMUST00000097386
Sequence
RNNRSLDWRQTIHAEYNILNLWNLPKGLGLKVKIGSFSANAPQGQQLFLSEQMIQWPEIF
SEIPQSACSESCGPGFRKVTLEGKAICCYKCTPCADNEISNESDVDQCVKCPEGHYANTE
KNNCLEKSVSFLAYEDPLGMALASIALCLSALTIFVIGIFVKHRDTPIVKANNRTLSYIL
LITLTFCFLCSLNFIGQPNTAACILQQTTFAVAFTVALATVLAKTITVVLAFKVSFPGRM
IRWLMISRGPNYIIPICTLIQLLLCGIWMATSPPFIDQDAHSEYGHIIILCNKGSAVAFH
SVLGYLCFLALVSYTMAFLSRNLPDTFNESKFLSFSMLVFFCVWVTFLPVYHSTKGKVMV
AMEVFCILASSTALFAFIFGPKCYIILLRPEKNSFRHTRKKTHIPVPKL
Download sequence
Identical sequences ENSMUSP00000094999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]