SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098528 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098528
Domain Number 1 Region: 31-509
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.67e-93
Family L-arabinose binding protein-like 0.0008
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000098528
Domain Number - Region: 520-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098528   Gene: ENSMUSG00000072778   Transcript: ENSMUST00000100968
Sequence length 857
Comment pep:known chromosome:NCBIM37:6:124141614:124181802:-1 gene:ENSMUSG00000072778 transcript:ENSMUST00000100968
Sequence
MKLLIAFSLVIVLISFQEKMSCFYISVPDSPGYNQDGDFLIGGFFSLRVTGREDRTEFCF
NETMNMTYGSYFNLPKHYQHILAMVFAVETINKDPNILFNMSLGFYLFDVDFIVMKAMES
CMVLISGERPPIPNYSCRPEKTNKPVAVIGGYSKAITAQISQVLSLYNVPQISYAPFDQS
LASRVQLQSPYQFPVHTAALYQGIIQLMLYFTWVWVGLVVPDDMRGELYITELTEDMTKH
GLCIAFAVRSPIFPCRNTVNLIILEEELGSLDVVLVYGDSYDFFWIVLYIPFLPFNGNVL
ITNSDWYTTFPYFHNQVYEYFGGVLLFSDHMDEILGFKEFLRNLQPRKYPQNIFIQDMWS
IVFECPHLYLHKVRELSQCEPNGSLSTRPLHVWDMNTSPMSYKVHAAVYAIAQALHVELS
VRVEGDSFDKGVLRAPLPWKLHPFLQNGQFVRLSNEENIVNKEGSATKLDIFNYQSLQSG
TEGHVKVGEFVFEPHRVQHLSLNEELIRWGEYHNMSALHVCSQTCPLGFSKIPDDWRPLC
CYDCAPCPDGEFANETDMDQCIKCPEDQYPNEQRNQCLPKITAFLSHEDTLGAVLGSMAI
SFAAFSAMILGLFIHYRDTPIVRANNRNLSYLLLVSLKLCFFCSLMFIGEPRRVTCLLRQ
MIFGVVFSVALSAVLAKTFIVVVAFKVIKPGSTLQMRMATQISNAIVCCGSIIQVCICAV
WLGTYPPFPDVDMHSEFGQIILWYNEGSTLAFYCVLGYLGFLASLSLFIAFLVRSLPDSF
NEAKTITFSMLVFCSVWISFVFTYLRSKAKTMVAVEIVSILASSAGLLSFIFLPKCYVIL
LRSGGYSRKKFFKSVSP
Download sequence
Identical sequences D3YUK6
ENSMUSP00000098528 ENSMUSP00000098528 NP_001098112.1.92730 ENSMUSP00000098528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]