SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100308 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100308
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Immunoglobulin 4.23e-45
Family V set domains (antibody variable domain-like) 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100308   Gene: ENSMUSG00000076718   Transcript: ENSMUST00000103527
Sequence length 98
Comment pep:known chromosome:NCBIM37:12:116481013:116481306:-1 gene:ENSMUSG00000076718 transcript:ENSMUST00000103527
Sequence
QVQLQQSGPELVRPGASVKISCKAPGYTFTSHWMQWVRQRPGQGLEWIGEIFPGSGSTYY
NEKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYFCAR
Download sequence
Identical sequences A0A075B5W7
ENSMUSP00000100308 ENSMUSP00000100308 ENSMUSP00000100308 10090.ENSMUSP00000100308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]