SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103375 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103375
Domain Number 1 Region: 414-528,648-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.15e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 23-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.08e-55
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Domain Number 3 Region: 544-647
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000267
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000103375
Domain Number - Region: 802-832
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0348
Family Phosphate binding protein-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103375   Gene: ENSMUSG00000033981   Transcript: ENSMUST00000107746
Sequence length 921
Comment pep:known chromosome:NCBIM37:3:80488858:80606713:-1 gene:ENSMUSG00000033981 transcript:ENSMUST00000107746
Sequence
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSK
EKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQN
SQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences ENSMUSP00000103375 10090.ENSMUSP00000103375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]