SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000103378 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000103378
Domain Number 1 Region: 50-465
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-75
Family L-arabinose binding protein-like 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000103378
Domain Number - Region: 781-822
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0602
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000103378   Gene: ENSMUSG00000039809   Transcript: ENSMUST00000107749
Sequence length 940
Comment pep:known chromosome:NCBIM37:4:46675190:47004745:-1 gene:ENSMUSG00000039809 transcript:ENSMUST00000107749
Sequence
MASPPSSGQPRPPPPPPPPARLLLPLLLSLLLSLAPGAWGWARGAPRPPPSSPPLSIMGL
MPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAI
KYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNA
VNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVK
KLKGNDVRIILGQFDQNMAAKVFCCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSR
CLRRSLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNSKRSGVGPSKFHGYAYDG
IWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGE
RMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPL
YSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDG
SFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIV
GGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVY
AYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQF
CIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVN
QASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILSLG
NFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHH
AYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
Download sequence
Identical sequences Q80T41
ENSMUSP00000103378 ENSMUSP00000103378 NP_001074610.1.92730 XP_021055688.1.100879 10090.ENSMUSP00000103378 ENSMUSP00000103378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]