SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104190 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104190
Domain Number 1 Region: 51-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-95
Family L-arabinose binding protein-like 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000104190
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0235
Family TNF receptor-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104190   Gene: ENSMUSG00000078802   Transcript: ENSMUST00000108550
Sequence length 852
Comment pep:known chromosome:NCBIM37:7:10560652:10577604:-1 gene:ENSMUSG00000078802 transcript:ENSMUST00000108550
Sequence
MFIFMGVFFLLNITLLMANFIDSRCFWRINLDEITDEYLELSCAFILAAVQTPIEKDYFN
KTLNFLKTTKNHKYALALVFAMDEINRYPDLLPNMSLIIRYSLGHCDGKTVTPTPYLFHR
KKQSPIPNYFCNEESMCSFLLSGPNWDESLSFWKYLDSFLSPRILQLSYGSFSSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYLKWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDEVSFPQKTEIYYKQIVKSLTNVIIIYGETYNFIDLIFRMWEPPILQRIWITT
KQLNFPTSKTDISHDTFYGSLTFLPHHGEISGFKNFVQTWFHLRNTDLYLVMPEWKYINS
EDSASNCKILKNSSSDASFDWLMEEKLDMAFSDNSHNIYNAVHAIAHALHEMNLQQADNQ
AIDNGKGASSHCLKVNSFLRRTYFTNPLGDKVFMKQRVIMQDEYDIVHFANLSEHLGIKM
KLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMFCFLCSFFFIGLPNKVICVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRYFLVSGTLNYIIPICSLLQCELCAIWLAVS
PPFVDIDEHSQHGHIIIVCNKGSVTAFYCVLGYLACLALGSFTLAFLAKNLPDAFNEAKF
LTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGMLGCIFVPKIYIILMRPER
NSTQKIREKSYF
Download sequence
Identical sequences D3Z6L3
ENSMUSP00000104190 PGOMOU00000128445-0 ENSMUSP00000104190 ENSMUSP00000104190 NP_001098626.1.92730 10090.ENSMUSP00000104190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]