SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000104194 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000104194
Domain Number 1 Region: 51-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-100
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000104194
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0129
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0183
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000104194   Gene: ENSMUSG00000078806   Transcript: ENSMUST00000108554
Sequence length 861
Comment pep:known chromosome:NCBIM37:7:9080032:9103001:1 gene:ENSMUSG00000078806 transcript:ENSMUST00000108554
Sequence
MFTLMGVFFFFNIPLFMANFIDPRCFWRINLNEIQDEYLGLTCAFILAAVQKPIEKDYFN
KTLNFLKTTKNHKYALALAFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFHK
KKQSPIPNYFCNEETMCSFLLTGPNWGVSISFWKYLDSFLSPRILQLTYGPFSSIFSDDE
QYSYLYQMAPKDTSLALAMVSFILYFNWNWIGLVIPDDDQGNQFLLELKKQRENKEICFA
FVKMISVDDISFEHKTEMYYKQIVMSSSNVIIIYEETIDFIDLIFRMWEPPVLQRIWITT
KQWNFPTSKRDITHGTFYGSLTFLPHHGGISGFKDFVQTWFHLRSKDLYLVMPEWKYFKY
ESSASKCKILKNNSSDASFDWLMEQKFDMAFSESSHNIYNAVHAIAHALHEMNLQQVDNQ
AIDNGKGASSHCLKVNSFLRKIHFTNPLGNKVIMKQRVIMQEEYDIFHFGNLSQHLGIKV
KLGKFSPYFSHGRNFHLYVDMLEVATGSRKMPSSVCSAECSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKYHDTPIVKANNRILSYILLISLMSCFLCSFFFIGHPNRATCVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWLEVS
PPFVDIDEHSQHGHIIIVCNKGSVTAFYCVLGFLACLALGSFSLAFLAKNLPDTFNEAKF
LTFSMLVFFSVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKIYIILMRPDR
NSTQKIKVRNSTQKIKEKSYF
Download sequence
Identical sequences G3UYA8
ENSMUSP00000104194 ENSMUSP00000104194 ENSMUSP00000104194 NP_001098540.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]