SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105308 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105308
Domain Number 1 Region: 79-194
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 201-325
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-18
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 3 Region: 324-360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105308   Gene: ENSMUSG00000036902   Transcript: ENSMUST00000109686
Sequence length 553
Comment pep:known chromosome:NCBIM37:8:88161136:88214872:-1 gene:ENSMUSG00000036902 transcript:ENSMUST00000109686
Sequence
MGTNAVTHSQTLGRAWGILWKNKDGMSQNDQGHHKKTYRINLPGPIVLLITVLVVEGIAV
AQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIE
LTFDERYYIEPSFECRFDHLEIRDGPFGFSPLIDRYCGMKSPALIRSTGRFMWIKFSSDE
ELEGLGFRAKYSFIPDPDFTYLGDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIK
ATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSAIENLKAKFCSTVANDVMLKTGVGVI
RMWADEGSRLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCK
EKKKAGLFEQITKTHGTIIGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEV
FDPPHYELFSLREKEISADLADLSEELDNYQKLRRSSTASRCIHDHHCGSQASSVKQSRT
NLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQAHECPEQALEDRVMEEIPCEIYVRG
RDDSAQASISIDF
Download sequence
Identical sequences NP_001074793.1.92730 XP_006531500.1.92730 10090.ENSMUSP00000105308 ENSMUSP00000105308 ENSMUSP00000105308 ENSMUSP00000105308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]