SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000106317 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000106317
Domain Number 1 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 77-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000491
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000106317   Gene: ENSMUSG00000079105   Transcript: ENSMUST00000110689
Sequence length 325
Comment pep:known chromosome:NCBIM37:15:4938762:5013740:-1 gene:ENSMUSG00000079105 transcript:ENSMUST00000110689
Sequence
MQVTSLLILVCFIAAFQVFSRASSPVNCKWDSYGPWSECNGCTKTQTRRRSVAVYGQYGG
YPCEGSAFETQSCKPERGCPTEEGCGDRFRCFSGQCISKSLVCNGDPDCEEDGADEDKCE
NVANPSCNIDKPPPNIELTGYGYNVVTGQGKKRVINTKSFGGQCRKVFSGDGKDFYRLSG
NILSYTFQVKVDNDFNYEFYNSSWSYIKHTSTEQNTFYSWKGLFSHSRNTYGHGSAKEEI
DTKMKSYKLLVVQNTVEVAQFTNNNPEFLQVAEPFWKELSHLPTLYDYSAYRRLIDQYGT
HYLQSGSLGGEYRVLFYVDSGSAKE
Download sequence
Identical sequences 10090.ENSMUSP00000106317 ENSMUSP00000106317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]