SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000108863 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000108863
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000294
Family V set domains (antibody variable domain-like) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000108863   Gene: ENSMUSG00000023992   Transcript: ENSMUST00000113237
Sequence length 249
Comment pep:known chromosome:NCBIM37:17:48485813:48491598:1 gene:ENSMUSG00000023992 transcript:ENSMUST00000113237
Sequence
MGPLHQFLLLLITALSQALNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPC
QRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEV
LQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRQVSSCGSPLAYHLPPLSKE
SRDLLPTHLHSSPPGLRSPEQVSCSQHPLGCGQGQAEAGNTCGQRAGLWPRCWAPTSDPH
WTRRYVREF
Download sequence
Identical sequences 10090.ENSMUSP00000108863 ENSMUSP00000108863 ENSMUSP00000108863 NYSGRC-IgSF-Q99NH8 ENSMUSP00000108863 NP_001259007.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]