SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110196 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110196
Domain Number 1 Region: 222-470
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.07e-91
Family Eukaryotic proteases 0.0000591
Further Details:      
 
Domain Number 2 Region: 126-232
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-20
Family Hepsin, N-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 92-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110196   Gene: ENSMUSG00000024034   Transcript: ENSMUST00000114549
Sequence length 475
Comment pep:novel chromosome:NCBIM37:17:31316217:31335920:-1 gene:ENSMUSG00000024034 transcript:ENSMUST00000114549
Sequence
MAASEMVEVEPEPNIRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDGDAVAA
QILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCHSSFKCIELTARCDGVSDC
KNAEDEYRCVRVSGQRAALQVFTAAAWRTMCSDDWKSHYAKIACAQLGFPSYVSSDHLRV
DALEEQFQGDFVSINHLLSDDKVTALHHSVYMREGCTSGHVVTLKCSACGTRTGYSPRIV
GGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYHPKSWTVQVGLVSLM
DSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLC
WTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGVDSCQG
DSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQLERDLKT
Download sequence
Identical sequences Q3TZ06
ENSMUSP00000110196 ENSMUSP00000110196 ENSMUSP00000024833 NP_001157248.1.92730 10090.ENSMUSP00000110196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]