SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000115854 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000115854
Domain Number 1 Region: 457-717
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-54
Family YWTD domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 39-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 250-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 4 Region: 159-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 199-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 7 Region: 78-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 8 Region: 373-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.0023
Further Details:      
 
Domain Number 9 Region: 115-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 10 Region: 409-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000724
Family EGF-type module 0.0014
Further Details:      
 
Domain Number 11 Region: 330-368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 12 Region: 727-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000213
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000115854   Gene: ENSMUSG00000028613   Transcript: ENSMUST00000143601
Sequence length 996
Comment pep:known chromosome:NCBIM37:4:107474866:107546772:1 gene:ENSMUSG00000028613 transcript:ENSMUST00000143601
Sequence
MGRPELGALRPLALLLLLLLQLQHLSAADPLPGGQGPVKECEEDQFRCRNERCIPLVWRC
DEDNDCSDNSDEDDCPKRTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKATCSSEE
CPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCPTLCAPHEFQCSNRSCLASVFVC
DGDDDCGDGSDERGCSDPACPPREFRCGGGGTCIPERWVCDRQFDCEDRSDEAAELCGRA
GQGTTATPAACAPTAQFTCRSGECIHLGWRCDGDRDCKDKSDEADCSPGPCRENEFQCGD
GTCVLAIKRCNQERDCPDGSDEAGCLQESTCEGPRRFQCKSGECVDGGKVCDDQRDCRDW
SDEPQKVCGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECQDPDACS
QICVNYKGYFKCECHPGYEMDTLTKNCKAVAGKSPSLIFTNRHEVRRIDLVKRDYSRLIP
MLKNVVALDVEVATNRIYWCDLSYRKIYSAHMDKASIPDEQVVLIDEQLHSPEGLAVDWV
HKHIYWTDSGNKTISVATTDGRRRCTLFSRELSEPRAIAVDPLRGFMYWSDWGFQAKIEK
AGLNGADRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLSSIDFNGGNRKMLIFSTDF
LSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILAENLNNPHDIVIFHELKQPKAA
DACDLSAQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRAPQSTSTTTLA
SAMTRTVPATTRAPGTTIHDPTYQNHSTETPSQTAAAPHSVNVPRAPSTSPSTPSPATSN
HSQHYGNEGSQMGSTVTAAVIGVIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNPVYR
KTTEEEEEDELHIGRTAQIGHVYPAAISNYDRPLWAEPCLGETRDLEDPAPALKELFVLP
GEPRSQLHQLPKNPLSELPVVKCKRVALSLEDDGLP
Download sequence
Identical sequences Q924X6
ENSMUSP00000030356 ENSMUSP00000115854 XP_011238759.1.92730 ENSMUSP00000115854 10090.ENSMUSP00000102345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]