SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122645 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122645
Domain Number 1 Region: 56-498
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.32e-100
Family L-arabinose binding protein-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000122645
Domain Number - Region: 507-553
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0191
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122645   Gene: ENSMUSG00000072241   Transcript: ENSMUST00000124773
Sequence length 851
Comment pep:known chromosome:NCBIM37:7:92143155:92160530:-1 gene:ENSMUSG00000072241 transcript:ENSMUST00000124773
Sequence
MFTLISVFWFLKISSIFCHLSDPRCFWRIKDTKNHLGDKENNCFFSIYTKRGYVKNDYFS
CNLDKQVTPKTIHLIFSVYLAIEEINKDYHILPNISLLVNIECDQRIYDKKSGLGLKSKE
IIPNYYCRNQRRYLIVLTIPEWTVSTSLGPFLYISRIPELYCGNFHLLLNDNEQFPHLYQ
ISPKDTSLPLAMVSLVVHFRWNWIGAIVTNDDHGIQFLSELRGEMQKHIVCLSVAIIIQT
EKIMALKEFHTHYNQIIMSSAKVVIVYGDKDSPIHFALIVWKSKGIWRIWVSVSQFDMIT
IIGDFLLYSSIGTFIFSHQQPEIPGFEQFIQTVHPSNYSSEHSLAKLWWTYFRCSLPPSN
CKKLKNCPTTTVFKWLFMTPLGMAMSNTCYNLYNGVYAVALSLHEMILQQVDTWSMNAGK
ELEFDSWKLFYFLKTLQFVNPAGELVIMNQNLKQDTEYDIFFIMDFKKYYGLKIKIGRFS
GHLPSGQQLLMSTEMIKWATGIDQILPSVCSMPCRPGLRKSPQEGKDICCFVCYPCPENE
ISNMTNMDQCVKCPEDQYANEDQTLCLQKVVAVLDYRDPLGKALAGFALCFSVLTSVVIC
VFLKHRETPIVKANNQTLSYVLLISLIFCFMSSLLYIGHPTMVICILQQTTFAIVFTVAA
STILAKTITVVLAFKATVPGRRMRWLLVSGAPKYIILICTMVQLILCGIWLRISPPFVDA
DIHMLHGQIIIVCNKGSVVAFYCVLGYMGSIALASFTVAFLARNLPHTFNEAKLLTFSML
VFCSVWITFIPVYHSTKGKTTVAVEVFCILASSAGLLLCIFAPKCYLILLRPQTNSFYKF
RRPHAKAENIS
Download sequence
Identical sequences K7N6R9
ENSMUSP00000122645 10090.ENSMUSP00000122645 NP_001029050.3.92730 ENSMUSP00000122645 ENSMUSP00000122645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]