SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124065 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124065
Domain Number 1 Region: 56-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.72e-107
Family L-arabinose binding protein-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124065   Gene: ENSMUSG00000070448   Transcript: ENSMUST00000159611
Sequence length 507
Comment pep:known chromosome:NCBIM37:14:52071637:52080968:1 gene:ENSMUSG00000070448 transcript:ENSMUST00000159611
Sequence
MKKLCAFTISFLSLKFSLILCCLTEASCFWRIKNSEDSDGDLQRECHFYLWVIDKPIEDN
FYNSVLNFRISASEYEFLLVMFFATDEINKNPYLLPNITLIFSIVGGHCHDLLRGLDQSY
TQINGRVNFVNYFCYLDDSCNIGLTGPSWKKSLKLAMDSSIPMVFFGPFNPNLRDHDRLP
HVHQVAPKDTHLSHGMVSLMFHFRWTWIGLVISDDDQGIQFLSDLREESQRHGICLAFVN
MIPENMQIYMTRATIYDKQIMTSSAKVVIIYGEMNSTLEVSFRRWEDLGARRIWITTSQW
DIILNKKEFTLNLFHGPITFAHHKVEIPKLRNFMQTMNTAKYPVDISHTILEWNYFNCSI
SKNSSKMDLFTSNNTLEWTALHNYDMAMSDEGYNLYNAVYVAAHTYHEHILQQVESQKKV
EHNRYFTVCQQVSSLMKTRVFTNPVGELVNMKHRENQCTEYDIFIIWNFPQGLGLKLKIG
SYIPCFPKSQQLHISDDLEWAMGGTSI
Download sequence
Identical sequences O35199
NP_033513.1.92730 ENSMUSP00000124065 ENSMUSP00000124065 ENSMUSP00000124065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]