SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124192 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124192
Domain Number 1 Region: 48-524
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.88e-113
Family L-arabinose binding protein-like 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124192   Gene: ENSMUSG00000062200   Transcript: ENSMUST00000161972
Sequence length 913
Comment pep:known chromosome:NCBIM37:3:64494582:64528955:-1 gene:ENSMUSG00000062200 transcript:ENSMUST00000161972
Sequence
MASRNKCLILGFTVFLWVELYTQYPHIDQNVTCRLLRKFNLTGYVEAENHSVVIGGLFPV
HYRTMPTSDSDEEIESPMCEGFNFRGFRWMKTMIHTIKEINERKDILPNHTLGYQIFDNC
FSITKAMESSSVFLTGQEEYKPNWRNSTGKFLIGIIGAGGSTMSAAVSRIVGIHHVPQVG
YASSSSIFSNDIQFPYILRTIPSDKFQSEAIVNLIRHFGWVWVGAIASDDDYGKYGVKFF
REEMESANLCVAFSETIPKVYSNEKMKIAVDAVKSSTAKVIVLYATDIDLSPFVLEVIHH
NITDRTWIATEAWITSALIAKPEYFPYFGGTIGFAVPRSVIPGLKEFLYDVHPSKDPNDV
LTIEFWQTAFNCTWPNSTVPYNVDHRVNMTGKEDRLYDMSDQLCTGEEKLEDLKSTYLDT
SQLRITNNVRQAVYLLAHAIDLFSQADIREEYRENAVLENKPNFESVKLWLYLTKIKFIT
HDGRKIELGRNGDVLNGSYDILNWHMDNTGEITFVKVGEYKFTSSKYEFVLPKNSTLFWN
TESSRLPDSVCTKVCPPGTRKGIHQGQPICCFDCIPCTDGYVSEKPGQRLCDPCGENDWS
NAEKNKCVPKHVEFLAYEEALGFTLVILSIFGALVVLAVTVVYVIHRHTPLVKANDRELS
FLIQVSLGITVLSSMLFIGKPCNWSCKTRQVTLALGFCLCLSSILGKTVSLFFAYRMSIS
KTRLISMHPIFRKLIVLICVVGEIGVCTAYLVLEPPSLFKNIEPQNVKIIFECNEGSIEF
LCSIFGFDVLLALLCFVTTFVARQLPDNYYEGKCITFGMLVFFIVWISFVPAYLGTKGKF
NVAVEIFAILASSYGLLGCVFLPKCFIILLRPKRNTDETVGGRVPTVDRSIQLTSASVSS
ELNSTTVSTVLDE
Download sequence
Identical sequences ENSMUSP00000124192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]