SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124342 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124342
Domain Number 1 Region: 32-511
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.24e-95
Family L-arabinose binding protein-like 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000124342
Domain Number - Region: 522-582
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0392
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124342   Gene: ENSMUSG00000072779   Transcript: ENSMUST00000162046
Sequence length 855
Comment pep:novel chromosome:NCBIM37:6:123772832:123803208:-1 gene:ENSMUSG00000072779 transcript:ENSMUST00000162046
Sequence
MKLLIAFSPLVVLILFQEHISCYYLTKYASSGYYQDADFVIGGLFSLRVTDGNTFISRSG
IEDTSHIPEYVFADLIKHYQHILAMVFAIEKINKDPNILFNKSLGFFLFNVNFIEMKAVE
GSMALLSGESPPIPNYSCRPEKTDKLVAVIGGISTSISIQISRVLSLYKVPQISYAPFDQ
ILGTRVQLQSPYQFSMHTAALYQGIVQLMLYFTWIWVGLVVPDDMRGELYLRDITEEMIS
HGICVAFAEKVTEYSSKNTVNWKRFMERFTLTPVIITFGDTHSLLRIVYFVIFYNLLGNV
WITTSDWYITTLPFEQNLIYTHFGGGLSFSFHMDEILGFKDFLRSVQPRKYPHDIFIRHV
WSSLFGCPHYYQHRLWDLSQCEPNGSLSTRPLHAWDMNTSPMSYKVHAAVYAIAQALHEE
LSLRVEGDSFDKVILQAPHPWKLHPFLQKGQVGRSTNEEYSVNKEVSAIKLDIFNYQSLQ
SGTEAHVKVGEFVFESHSVQHLSLNDKIITWGEHHNQTPLSVCSQSCPLGFSKTAVEGKP
FCCFDCVPCPDGEIANKTDMHQCIKCPEDQYPNKQRNQCLPKIMVFLAHEDPLGTVLVSL
AISLSAFSAMILGLFICYRETPIVRANNRNLSYLLLISLKLCFFCSLIFIGQPRTVTCVL
RQIIFGIVFSIVISAILAKTFIVVVAFKAIKPGSILKMGMVTRLSNAIVCCGSIIQVCIC
AVWLGTYPPFPDVDMQSEFGQVILWCNEGSTLAFYCVLGYLGFLASLSLLIAFLARRLPD
SFNEAKTITFSMLGFCSVWISFIPTYLSSKGKTMVAVEILSILASSAGLLGCIFLPKCYV
ILLKSGGHSRKKFFK
Download sequence
Identical sequences W4VSP2
ENSMUSP00000124342 ENSMUSP00000124342 NP_001098111.1.92730 ENSMUSP00000124342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]