SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125126 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125126
Domain Number 1 Region: 9-454
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.63e-108
Family L-arabinose binding protein-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000125126
Domain Number - Region: 533-648
Classification Level Classification E-value
Superfamily Clc chloride channel 0.00811
Family Clc chloride channel 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125126   Gene: ENSMUSG00000000606   Transcript: ENSMUST00000159674
Sequence length 803
Comment pep:novel chromosome:NCBIM37:14:52030814:52039052:1 gene:ENSMUSG00000000606 transcript:ENSMUST00000159674
Sequence
HFYLGAVDKPIEDNFYNSLLKFRIAASEYEFLLVMFFATDEINKNPYLLPNITLMFSIIG
GNCHDLLRGLDQAYTQINGHMNFVNYFCYLDDSCAIGLTGPSWKTSLKLAMHSSMPLVFF
GSFNPNLHDHDRLHHVHQVATKDTHLSHGIVSLMFHFRWTWIGLVISDDDKGIQFLSDLR
EESQRHGICLAFVNMIPENMQIYMTRATIYDKQIMTSLAKVVIIYGEMNSTLEVSFRRWE
NLGARRIWITTSQWDVITNKKEFTLNLFHGTITFAHRRFEIPKFKKFMQTMNTAKYPVDI
SHTILEWNYFNCSISKNSSKMDHITFNNTLEWTALHNYDMVMSDEGYNLYNAVYAVAHTY
HEHIFQQVESQKKAKPKRFFTVCQQVSSLMKTRVFTNPVGELVNMKHRENQCTEYDIFLI
WNFPQGLGLKVKIGSYLPCFPQRQELHISDDLEWAMGGTSVVPSSVCSVACTAGFRKIHQ
KETADCCFDCVQCPENEVSNETDMEQCVKCPYDKYANIEKTHCLSRAVSFLAYEDPLGIA
LGCIALSFSAITILVLITFLKYKDTPIVKANNRILSYILLISLVFCFLCSLLFIGHPNQV
SCVLQQTTFGVFFTVSVSTVLAKTITVVMAFKLTTPGRRMREMLVTGAPKLVIPICTLIQ
FVLCGIWLITSPPFIDRDIQSEHGKIVILCNKGSVIAFHVVLGYLGSLALGSFTLAFLAR
NLPDTFNEAKFLTFSMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLMCIFVP
KCYVILVRPDSNFIRKYKDKFRY
Download sequence
Identical sequences ENSMUSP00000125126 ENSMUSP00000125126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]