SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125817 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125817
Domain Number 1 Region: 33-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-125
Family L-arabinose binding protein-like 0.0000904
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000125817
Domain Number - Region: 515-561
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0195
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125817   Gene: ENSMUSG00000066537   Transcript: ENSMUST00000165029
Sequence length 863
Comment pep:known chromosome:NCBIM37:7:48655102:48704011:-1 gene:ENSMUSG00000066537 transcript:ENSMUST00000165029
Sequence
MFWIFIFGVLYIPNFVCAFTGYMCYETIEEYTYHEGDLTIGAFFPLHIYSTRNHVPHELD
PYYFQDMYLEYNFMNYQFLLALMFTIQEINRNPHLLPNTTLGFEHHNIKFSEKNILLGPF
LWLSGLSNQLVNYNCGQKRNLPAALTGTSWAISAHIGTLLQLYKIPQFTFGHFDSNMNDQ
SQYKTLFQVAPEDTYLSLALVSLMLYFSWSWVGLIVPNDPRGTQILSDFREVMESNRICL
AFVKMIPGTWNSYSDAIWKNMEKIQESSANVIIIYGDTVSLQGLMRHIAQLLVTWKVWVL
NSQWDIDYYSDYFMIESFHGSLIFSHHHEEMVEFVNFVQTVNPYTYPEDAYLPKFWVFFF
NCSFSEFDCQLLENCQPNASLDLLPRHIFDPAMSEESYNIYNAVYALAHSLHEMTVQQIQ
TQPYANGEGMAFSPWQILPFLKITLLKNHPSGQTVIDERKNLYSEYDIFNFWNFPTGLGL
KMKVGTFSPNSPQGHRLSLSEEMIQWPTQFTKIPQSVCSESCRPGFRKAAQEGKAVCCFD
CIPCADNEISNETDMDQCVQCPESHYANSEKNHCLQKSVSFLAYEEPLGIALTITALDFS
VLTALVLVVFVKHRDTPIVKANNRVLSYILLLTLIICFLSCLLYIGQPNTATCILQQTAF
GTLFTVALSTVLAKAIVVVTAFKVTSPSRMVRWLIVSRAPNLIIPICTLIQLIICGIWLA
TFPPFIDQNAHVEHGHIIIMCNKGSAVAFHCVLGYLCSLALGSYTMAFLSRNLPDTFNEA
KCLSFSMQVFFCVWITFLPVYHSTKGKVMVAMEVFSILASSTSFLALIFVPKCYIILLRP
DKNSCLDIRNKIHSRRSSHLKFI
Download sequence
Identical sequences L7N269
ENSMUSP00000125817 ENSMUSP00000125817 NP_808432.2.92730 ENSMUSP00000125817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]