SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126165 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126165
Domain Number 1 Region: 19-496
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-99
Family L-arabinose binding protein-like 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126165   Gene: ENSMUSG00000091572   Transcript: ENSMUST00000170244
Sequence length 887
Comment pep:known chromosome:NCBIM37:3:64062883:64091339:-1 gene:ENSMUSG00000091572 transcript:ENSMUST00000170244
Sequence
MTCRLMRKFNLTGYVEAENHHFVIGGQFPVHYRTIPTTSPFLTQIEASGSQMLFLSRFNF
RGFRWMKTMIHTIKEINERKDILPEHTLGYQIFDNCFSTTKAMESSMVFLTGQDEYKPKW
RNSTGKYLIGIIGAGGSTMSLAGARILLNYKYFQFQVGYASSSSILTEYLNVYRTIPSDK
FQTEAIVNLIRHFGWVWIGAIASDDDYGKHGVKSFRKILETNNLCIAFSETIPKVYSNEK
MQIAIDAVKSSTAKVIVLYATDFDLSPFVLEVIHHNIAHRTWIATEAWITSALIAKPEYF
PYFGGTIGFAIPRSVIPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNSSVPYNVDH
RVNMTGKEDRLYDMSDHLCTGKEKLKDLKNTYLDTSQLRITNNVRQAVYLMAYGLDRLIR
VLIKEYREYLLHPKILAFMSYKLFEYIRKVKFTTHDGRKIELNVHGDIENGYYDILNWQM
DNTGDIAIVKVGEYKFTRSKYELVLPKNSTLFWNTESSRLPDSVCTKVCPPGTRKGFITG
QPVCCFDCIPCEDGYVSEKPGQRLCNPCSEDDWSNAEKNKCVPKHVEFLAYEEALGFTLV
ILSIFGALVVLAVTVVYVIHRHTPLVKANDRELSFLIQISLVITVLSTMLFIGKPCNWSC
MARQVTLALGFCLCLSSILGKTISLFFAYRISISKTQLISMHPSFRKLIVLLCVFGEIGV
CASYLVLKPPSMFKNIERQNVKIIFECNEGSVEFLCSIFGFDVLLALLCFVTTFMARQLP
DNYYEGKCITFGMLFFFIVWISFVPAYLSTKGKFKVAVEIFAILASSYGLLGCLFLPKCF
IILLRPKRNTDETVGGRVPTVDRSIQLTSASVSSELNSTMVSTVLDE
Download sequence
Identical sequences E9Q107
NP_001098084.1.92730 ENSMUSP00000126165 ENSMUSP00000126165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]