SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126534 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126534
Domain Number 1 Region: 36-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.67e-112
Family L-arabinose binding protein-like 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126534
Domain Number - Region: 506-574,637-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0314
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126534   Gene: ENSMUSG00000091656   Transcript: ENSMUST00000167464
Sequence length 862
Comment pep:known chromosome:NCBIM37:17:20404511:20422394:-1 gene:ENSMUSG00000091656 transcript:ENSMUST00000167464
Sequence
MLYWTFILWFLQIPKFVSAIMTVNISKCYYKTTEDFHHEGDVMIGAFFPIHTYYSAKKIP
HPFLPYYYLDNHIQYNFKNYQYILALLFAIEEINGNPNILPNISLGFDFYNVRFTEKDTL
MNAFNWFTNRRKKKILPNYNCNKKKFSAALTGTSWTTSAQISTLFQLFKFPQLSYGPYDP
ILSDRSQYFSLYQMAPKYTSLSHGIVSLMVHFRWSWVGLILPDDHKGNKILPEIKEDMQR
KGVCIAFVKMIPATWTSHFSKFWENMDEVNVIIIYGDIDSLEILMRNIGQRLLTLKVWVL
NIEPHVTDYADYFLLDSFHGSLIFTHHYRKNFEFTNFIQTVNPYKYPEDIYLPKLWHLFF
KCSFSDIDCQLLANCQANASLDVLPCHIFDIAISEESKTIYNAVYALAHSLHVMSIQQIQ
IQPHENGDVLVFSPWQVITILNTFLKEIDERDNMSLDWRQKLNAEYDILNLWNLPKGLGL
KVKIGSFSANTAQHQQLSLSEEMIQWPEGFLDIPQSVCSESCKPGFRKIILEGKAICCYN
CTPCAEDEISNETDVDQCVKCPESHYSNTEKNHCFQKTVIFLAYEDPLGMTLACIALCLS
ALTAFVIGIFVKYRDTPIVKANNRALSYTLLITLTFCFLCSLNFIGQPNLTTCILQQTTF
GVAFTMALATVLAKAITVVIAFRATFPGRMVRWLMMSRVPNYIIPICTLIQLLLCGIWMA
ISPPFIDNDVHTEHGYIIIFCNKGSSFAFHCVLGYLCSLAFGGYTMAFLSRNLPGTFNES
KFLSFSMLVFFCVWVTFLSVYHSTKGKFMVAMEVFAILASSSALLGFIFGPKCYIILIRP
DRNSFHHIRDKTHSRRNKTYVM
Download sequence
Identical sequences E9PY92
NP_001098038.1.92730 ENSMUSP00000126534 ENSMUSP00000126534 ENSMUSP00000126534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]