SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126698 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126698
Domain Number 1 Region: 58-498
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.41e-103
Family L-arabinose binding protein-like 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126698
Domain Number - Region: 507-553
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0753
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126698   Gene: ENSMUSG00000091962   Transcript: ENSMUST00000170835
Sequence length 853
Comment pep:known chromosome:NCBIM37:7:94063859:94103687:1 gene:ENSMUSG00000091962 transcript:ENSMUST00000170835
Sequence
MFSLIVVFLLLKLSFLFCSLSDPRCFWRIKDRENDLGDKETDCFFSIYTKRGYVKNDYFS
ENLDKKVTLKTIHLISSVYFAAEEINKNIYILPNISLIVKIECNLIADNVKRIWSLKKKE
IIPNYYCKNQRRYLIVLTGPIWITSYILGPFLYFSQTPELYCGHFHFLLNDQEQFPHLYQ
MTPKDTSLPQGMVSLAVHFRWNWVGVIITDDDHGIQFLSELRTGMESNTVCLAFVTIITY
NRMLYLKMYHKYYHQITMSSAKVVIVYGDKESPLQFNFILWKSENIQRLWVSVSQFDMIT
VIRDFMLNSLHGTLIFSHQQSEISGFKQFMQTVHPSNYSNDISLAKMWWTYFKCSLKPPD
CKTLKNCPTKTLFKWFFVPPLGMSMSETCYNLYNSVYAVAHSLHEMLLQQVDTCSENDGT
VMEFNSWKMFYFLKTIQFVNPAGDLINMNQNRERDTEYDIFYIMDFLKHEGLKMKIGRFS
GHFPNGQQLFMSDEMIEWATDIKQTLASACSVPCRPGLRKYFQEGKAVCCFDCYPCPENE
ISNMTDMDQCVKCPEDEYANTDQTNCLKKVVTFLDYKEPLGMALAVLAVFFSSLTFIILC
VFLKHRDTPIVKANNETLSYVLLTSLIFCFICSLLYIGYPTMVSCILQQTTFALVFTVAA
SCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNYIIPICTTIQMILCGIWLGTSPPFVDA
DLHMIHEHIIIVCNKGSVTAFYCVLGYMGSLALASFTVAFLARNLPDTFNEAKLLTFSML
VFCSVWVTFLPVYHSTKGKAMVAVEVFCILASSAGMLLCIFVPKCYLILLRPQINSFHEF
RKIHAKSININRM
Download sequence
Identical sequences K7N6U5
ENSMUSP00000126698 ENSMUSP00000126698 ENSMUSP00000126698 NP_001098659.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]