SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126863 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126863
Domain Number 1 Region: 51-491
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.74e-97
Family L-arabinose binding protein-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126863
Domain Number - Region: 607-795
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00222
Family Calcium ATPase, transmembrane domain M 0.018
Further Details:      
 
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00859
Family TNF receptor-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126863   Gene: ENSMUSG00000090342   Transcript: ENSMUST00000171523
Sequence length 809
Comment pep:known chromosome:NCBIM37:7:10339985:10355920:-1 gene:ENSMUSG00000090342 transcript:ENSMUST00000171523
Sequence
MFILMGVFFLLNIPVFMANFTDPVCFWRINLNEIQDEYLGLTCAFILAAVQKPIEKDYFN
KTLNFLKTTKNHKYALALAFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFHK
KTKSPIPNYFCNEETMCSFLLTGTHWEVSLSFWKYLDSFLSPRILQLTYGPFSSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFSWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDYVYLEPEIEMYYKQIVMSSSNVIIIYEEKDNFFDLIFRMWEPPVLQRIWITT
KQWNCPTSKRDITHGTFYGSLTFLPHHGEISGFKNFVQTWFNLRNKDLYLVMPEWKYFKY
EGSASNCKILKNNSSDASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIDNGKGASSHCLKVHSFLRKTHFTNPLGDKVIMKQRVITQEDYDVFHFGNLSQHLGIKL
KLEKFSPYFSHGRHFHLYIDMIEVATGSRKMPSSVCSAECSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRILSYILLISLMSCFLCSFFFIGHPNRATCVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFVVSGTPNYIIPICSLLQCVLCAIWLAVS
PPFVDIDEHTLHGHIIIVCNKGSVTAFYCVLGYLACLALGSFTLAFLAKNLPDTFNEAKF
LTFSMLVFFSVWVTFLPVYHSTKGKVMCY
Download sequence
Identical sequences L7N282
ENSMUSP00000126863 ENSMUSP00000126863 ENSMUSP00000127146 NP_001098546.1.92730 ENSMUSP00000126863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]