SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126885 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126885
Domain Number 1 Region: 51-504
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.69e-110
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 607-815
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000575
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126885
Domain Number - Region: 514-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126885   Gene: ENSMUSG00000091407   Transcript: ENSMUST00000171996
Sequence length 857
Comment pep:known chromosome:NCBIM37:17:23596642:23616564:-1 gene:ENSMUSG00000091407 transcript:ENSMUST00000171996
Sequence
MFTLIFLFWLLNIPLLVSDFIYPRCFWKIKQNEDKNRNQGTECTFMIHAVQRPVEKEYFS
HILNIQTHTENHKYALALAFSIYEINRNPDILPNMSLTFKFSNYNCHWKSKYNSFIHLSL
QNHDILPNYMCKEFTKCAMALTRLNWATTVKLNTILNNFMSQQFLQITYGPFHPVLSDHE
KFPYLYQMASDHTSLALALVSFIIHFSWNWVGLVISDNDEDIQFLSYLRREMEKNTVCFA
FVNMIPMSMNLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITT
SQWDVSPSMKDFTFGNEYGTFAFGQHHSEISGFKHFVQTLNSVKCPDEYLVKLEWMHFNC
EVSASKCKTLKNCSSNHSLEWLMVHTFDMAFIEGSYDIYNAVYAFAHALHQIAFQKLDNL
PKDNGKEHNYSCKKLYSFLRKTQFTNPVGDRVNMNRRNKLQEEYDIFYIWNFPQGLGLRV
KIGMFSPYFPNGQQVHLSEDMIEWAKGSAQVPTSVCSAECGPGSRKFRMDGMAACCFHCK
PCPENEISNETNVDYCVQCLEDQYANTEQNQCIRKTVVFLSYEEPLGMALSLLSLCFSAF
TTVVLGVMVKHHSTPIVKANNRTLTYILLISLIFCFLCPLLFIGHPNAATCILQQITFGV
VFTVSVSTVLAKTITVVLAFKITASQRMMKYFLVSGAINYIIPICILIQVIVCAVWLRAS
PPSVDIDAHSEHGQIIIVCHKGSVNAFYCVLGYLATLAIGSFTLAFFSRNLPGAFNEAKS
ITFSMLVFCSVWVTFIPVYYSTKGKVMVAVEIFSILASSAGMLGCIFVPKCYTILFRPDQ
NSLEMIRVKSSSNAHVS
Download sequence
Identical sequences D7URW6 K7N6V1
ENSMUSP00000126885 ENSMUSP00000126885 ENSMUSP00000126885 NP_001098051.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]