SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126953 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126953
Domain Number 1 Region: 64-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.41e-104
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126953
Domain Number - Region: 505-555
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0125
Family TNF receptor-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126953   Gene: ENSMUSG00000090961   Transcript: ENSMUST00000172140
Sequence length 848
Comment pep:known chromosome:NCBIM37:5:109226212:109237773:-1 gene:ENSMUSG00000090961 transcript:ENSMUST00000172140
Sequence
MKKLRTFTISFLLLKFSLILCHVTDPICFWRIKNNEENDGDLRSDCNFLLWTDYESTEFN
FYNIVDFRIPARRYEYFLVLFFATDEINKNPDLLPNMSLIVWLLSGQCGDEWSVLHKNYS
QENINVKFINYDCLSPACYIDLTGPSWKTSLKMSIQSRTPKVFFGPFNPDLRDHDQFPFV
HQVATKDTYLSHAMVSLMHHFRWMWIGLVISDDDQGIQFLSDLREEMQRHGICLAFVNMI
PENMQIYMTRATIYDKQIMESTAKVVIIYGEMNSTLEVSFRRWEDLGVRRIWITTSQWDV
ITNKNDFSLDFFHGTVTFEHHHSEIAKFKNFMKTMNTDKYPVNISQSIVGWNYFNCSTSM
NSFSKMDHLTFNNTLEWTALHNFDMVLSEEGYNLYNAVYAVAHTYHELILLQVESQQTEV
PKGIFTDCQQVASMLKSRIFTNPIGELVNMKHRENQCADYDIFIIWNFPQGLGLKVKIGS
YLHCFSQSQQLHISEDLEWATGGTSVPSSLCSVTCTAGFRKIHQNETADCCFDCDQCPEN
EVSNETADMEQCVRCPDDKYANLEKTHCLQRAVSFLAYEDPWGMALGCMALFLSALTVLV
LVTFVKYKDTPIVKANNRILSYILLISLVFCFLCSLLFIGHPNQATCILQQTTFGVFFTV
AISTVLAKTITVLMAFKLTTPGRRMRGMLASGAPNLVIPICTLIQLFLCGIWLVTSPPFI
DRETQSEYGKTIIICNKGSVIAFHFVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTFS
MLVFCSVWITFLPVYHSTRGTVMVVVEVFSILASSAGLLGCIFLPKCCVILVRLDSNFLQ
KYKDKLPS
Download sequence
Identical sequences L7N472
ENSMUSP00000126953 ENSMUSP00000126953 ENSMUSP00000126953 NP_001098090.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]