SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126966 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126966
Domain Number 1 Region: 32-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-123
Family L-arabinose binding protein-like 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000126966
Domain Number - Region: 504-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000889
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126966   Gene: ENSMUSG00000090383   Transcript: ENSMUST00000171671
Sequence length 862
Comment pep:known chromosome:NCBIM37:7:49092251:49128040:-1 gene:ENSMUSG00000090383 transcript:ENSMUST00000171671
Sequence
MFWIFTFGLLCIPIFVCAFTDNECYVTCSDYFYREGDVTIGAFFPLHIYYTGNKVPGKYL
PYSFQDYRVQYKFKNYQFVLALVFAIEEINRNPDLLPNTTIGYDIYNIPFTEKNILRSIF
LWRTRIINPLPNCDCGQKRKSPVVLTGPSWSASAHIGTFLQLYKIPQVTFGPFDSILNDR
GQFNSLYQMSPKDTSLSLAIVFLLLQFRWSWVGLIIPDDHRGTQILSDLRENMENHGICI
AFLKIISSAWNAFSNELWKNMYKIEESSANVIVIYGDIISVQGLMRHIAQLLVTWKVWVL
SSSWDVDTHSDYFMVESFHGSLVFSHHHDEMVEFMNFVQTVNPYKYPEDNYLPKFWHLFF
KCSFSEFNCQLLENCQPNASLDLLPRHHFDPAMNEEGYNIYNAVRAVAYSIHEMNLQKIQ
TQPYAKGEEMVFFQWQLHPFLKNTIMRSHIGRHTATHGGGNLDAQYDILNFWNFPSGLGL
KVKVGTYSLSAQQGPQFSLCEQMIQWPTGFTMTPQSVCSKSCRPGFRKAVQEGKAVCCFD
CIPCADNEISNETDMYQCMKCPESHYANSEKSHCLQKSVSFLAYDEPLGMALIITALCFS
LLIAAVLVVFVKHRDTPIVKANNRTLSYILLLTLFICLLSSFLFIGQPNTTTCILQQTAF
GILFTVALSTVLAKAITVVIAFKATVPARMVRWLMVSRAPNFIIPICTLIQLIICGIWLV
TSPPFIDQDTQTEHGHIIIVCNMGSTVAFHTVLGYLCSLALGSYTMAFLSRNLPDTFNEA
KFLSFSMQVFFCVWITFLPVYHSSKGKVMVVMEVFSILASSVALFILIFAPKCYIILLRP
EKNSCHNVRHKKHSRRNINLFT
Download sequence
Identical sequences K7N6V2
ENSMUSP00000126966 NP_001098525.1.92730 ENSMUSP00000126966 ENSMUSP00000126966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]