SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127329 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127329
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-48
Family YWTD domain 0.000000091
Further Details:      
 
Domain Number 2 Region: 234-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000275
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000589
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 4 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 5 Region: 148-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 7 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 8 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 9 Region: 326-436,698-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000596
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 10 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127329   Gene: ENSMUSG00000024924   Transcript: ENSMUST00000167487
Sequence length 873
Comment pep:known chromosome:NCBIM37:19:27291847:27328721:1 gene:ENSMUSG00000024924 transcript:ENSMUST00000167487
Sequence
MGTSARWALWLLLALCWAPRDSGATASGKKAKCDSSQFQCTNGRCITLLWKCDGDEDCAD
GSDEKNCVKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISC
GARSTQCIPVSWRCDGENDCDNGEDEENCGNITCSADEFTCSSGRCVSRNFVCNGQDDCD
DGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
TSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHFKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGAKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQ
WPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEDDMENGGCEYLCL
PAPQINDHSPKYTCSCPNGYNLEENGRECQSTSTPVTYSETKDINTTDILRTSGLVPGGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences P98156
10090.ENSMUSP00000025866 ENSMUSP00000049145 ENSMUSP00000127329 NP_038731.2.92730 XP_006526980.1.92730 XP_006526981.1.92730 ENSMUSP00000127329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]