SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127505 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127505
Domain Number 1 Region: 44-503
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.01e-107
Family L-arabinose binding protein-like 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000127505
Domain Number - Region: 511-558
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00282
Family TNF receptor-like 0.0098
Further Details:      
 
Domain Number - Region: 606-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0222
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127505   Gene: ENSMUSG00000091945   Transcript: ENSMUST00000168033
Sequence length 856
Comment pep:known chromosome:NCBIM37:17:23427901:23449280:-1 gene:ENSMUSG00000091945 transcript:ENSMUST00000168033
Sequence
MFTLIFLFWLLNIPLLLADFISPRCFWKMKQNENRDRNQGTGCTFMIHAVQRPVEKEYFS
HILNIQTHAENYKNVLALAFSIYEINRNPDILPNMSVRFTISKYNCYWESELMSLIHLSL
QNHDILPNYMCKELTRCTMALTRLNWVTTVKLNTILNNFISQQFFQITYGPFHPVLSDHE
KFPYLYQMASDHTSLALALVSFIIHFSWNWVGLAISDNDQGIQFLSYLRRVMEKNAVCFA
FVNMIPMSMNLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITT
SQWDVSPSMKDFTFGNEYGTFAFGQHHSEISGFKHFVQTLNSVKCPDEYLVKLEWMHFNC
EVSASKCKTLKNCSSNHSLEWLMVHTFDMAFIEGSYDIYNAVYAFAHALHQIAFQKFDLP
KDNGKEHNYSCKKLYSFLRKTQFTNPVGDRVNMNQRDKLQEEYDIFYIWNFPQGLELRVK
IGMFSPYFPNGQQVHLSEDMIEWAKGSAQMPTSVCSAECGPGSRKFRMDGMAACSFHCKP
CPENEISNETNVDYCVQCLEDQYANTEQNHCIRKTVVFLSYEEPLGVALSLISLFFSAVT
IVVLGVIVKHHSTPVVKANNRTLTYILLISLIFCFLCPLLFIGHPNAATCILQQITFGVV
FTVSVSTVLAKTITVVLAFKITASQRMMKYFLVSGAINYIIPFCILIQVIVCAVWLGASP
PSVDIDAHSEHGQIIIVCHKGSVNAFYCVLGYLATLAIGSFTLAFFSRNLPGAFNEAKSI
TFSMLVFCSVWVTFIPVYHSTKGRVMVAVEIFSILASSAGMLGCIFVPKCYTILFRPDQN
SLEMIRAKSSSRAHIS
Download sequence
Identical sequences D7URW3 E9Q281
ENSMUSP00000127505 NP_001096054.1.92730 ENSMUSP00000127505 ENSMUSP00000127505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]