SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127506 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127506
Domain Number 1 Region: 2-440
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-92
Family L-arabinose binding protein-like 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000127506
Domain Number - Region: 439-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0121
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127506   Gene: ENSMUSG00000091794   Transcript: ENSMUST00000165928
Sequence length 788
Comment pep:known chromosome:NCBIM37:5:152364236:152389499:-1 gene:ENSMUSG00000091794 transcript:ENSMUST00000165928
Sequence
MTLYFAIDEINKDTHLLPNVTLGFHIYNAFNFHPRTLEGPLMWLSGRNEFIPNYKCKTQY
KALGIISGTRSEYSAGIGSLLERYKIPQVSFALLLQVNYGPFDSMLSDKDTFPSLYQMSP
KDTALTQGVISVLLHFGWKWVGVIVSDDLKGMEFLSHLKAEMVSEDICVAFTKSLKTNWK
VQYTSGVGLANLNHHPQVNVNILYGDIDDLLYFCLENKLLSSRRKVWIMAKLHLVYLESV
FFKRKDLINFFTGSLLFSKKRNIPGFKNFLESLTPSYYPGEFYFYKFWIDKFDCAPPALL
CGRNKPCPLNITLKNKEGENDIMIPSEASYSIWNTVYAVAHAIHNMFLRKTEIGSHEDKN
HDRFLPWQLHPFLRKIQFTNTAGDPISFDEHKNHMEIYEIQNFMKYTKQHSYLVKVGEFV
SKSPQDQSLFINESLIKWPNNFNQTPQSVCTQSCGPGFWKILQEERPVCCFSCVPCPEKH
ISNLTDQQKCIACLIQEYPNPERNHCLPKSATFLSFEDPLGMSLACMALGFSVSTAAVLG
IFLKYQDSPIIKANNLTLSYILLISLLLCFLCSFLFIGHPNTVSCILQQITFALVFTLAL
STVLAKTITVILAFRALKPGRTMRRLFVLGIYNAVIPFCVLIQLITSGIWLATSPPYIDT
DSYSEHAHIIILCNNGSVTAFYCMLVYLGTLALGSFTVAFLARNLPDTFNEAKFLTFSMV
VFCSVWVTFVPVYQSTKAKAMVAVEVFSILASSAGLLACIFFPKCYIILREPDKRNLKCF
KNKTRIKK
Download sequence
Identical sequences E9Q280
ENSMUSP00000127506 ENSMUSP00000127506 NP_001096052.1.92730 ENSMUSP00000127506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]