SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127981 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127981
Domain Number 1 Region: 51-503
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.36e-110
Family L-arabinose binding protein-like 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000127981
Domain Number - Region: 512-571,634-651
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0154
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127981   Gene: ENSMUSG00000092111   Transcript: ENSMUST00000170322
Sequence length 856
Comment pep:known chromosome:NCBIM37:17:23080151:23095781:1 gene:ENSMUSG00000092111 transcript:ENSMUST00000170322
Sequence
MFTLILLFLLLNIPLIVADFIDPRCFWRIKQNKDEDGNLGSGCSFFIQAVQWPVEKEYFS
SILNTQTHTENHKYALVLAFSINEVNRNSDLLPNMSLIFTFSALICDYESQLKSLIHLSL
QNHEIFPNYICNDDVCAVALTGLNWTTTLTLYTILNNFISHQFLHLTYGPFHPVLSDHEE
FPYLYQMASEDTSLALAMVSFIIHFSWNWVGLAISDNDKGIQFLSYLRREMEKNTVCFAF
VSMIPVNMHLYMTRTEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLDIKRIWVTTS
QWAITTGKKDFTFNNLYGTFAFGHHHGEISGFKNFVQTLNLLKYSDEYLVKLEWMYFNCE
VSAPKCKTLKNCSSNHPLEWLMVRTFDMAFTEGSYAIYNAVYAVAHALHELTFQKFDNLP
TDNVKEQNYACNKLGSFLRKIHFTNPVEDRVNMNQRNKLQENYDIFYVWNFPQGLGLKVK
IGIFSPYIINGQQLHLSEDMLEWARGSTQMLTSVCSADCGPGFRKFGKNGMPACCFDCSP
CPENEISNETNVELCVPCPEDQYANTEQNHCIHKALIFLTYKDPLGMALSLMALCFSAFT
AVVLLVFVKHHSTPIVKANNRTLTYILLISLIFCFLCPLLFIGHPNSVTCILQQVTFGVA
FTVAVSTVLAKTITILLAFRVTAPQRMMKYFLVSGTYIYIIPICTLIQVIVCAVWLGAAP
PSVDIDARSEHGHIIIVCNKGSVSAFYCVLGYLACLAFGSFTLAFLSRNLPSTFNEAKSI
TFSMLVFCSVWVTFLPVYHSTKGKVMVAVEIFSTLASGAGMLICIFVPKCYIILFMPDRN
SLQMIRKKSSSHAHLS
Download sequence
Identical sequences D7URW7 E9PZA6
ENSMUSP00000127981 NP_001098048.1.92730 ENSMUSP00000127981 ENSMUSP00000127981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]