SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128015 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128015
Domain Number 1 Region: 65-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-103
Family L-arabinose binding protein-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128015
Domain Number - Region: 507-555
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0306
Family TNF receptor-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128015   Gene: ENSMUSG00000091059   Transcript: ENSMUST00000170341
Sequence length 848
Comment pep:known chromosome:NCBIM37:5:109644521:109653641:-1 gene:ENSMUSG00000091059 transcript:ENSMUST00000170341
Sequence
MKNLRGFGLSFMLLKFSLIWCHLTEPICFWRIKNNEDNDGDLRSDCGFFLAAVEGPIDHT
YNISDFRIPARRHEFFLVLFFATDEINKNPYLLPNMSLIFPEDPGQCEKLLGELDKIHSE
AKFTVDFTDYICAGYGTCYIGLIGPSWKTSVKLSTNSGTPRVFFGPFNPKLSDHDQFPYV
HQVATKDTHLSHGMITLMLHFRWTWIGLVISDDDQGIQFLSDLREEMQRHGICLAFVNMI
PEDMQLYMTRAKIYDKQIMESTAKVVIIYGEMNSTLEVSFRRWEDLGARRIWITTSQWDV
ITNKNDFSLDFFHGTVTFEYHHSEIAKFKNFMKTMNTDKYPVNISESILRWNYFNCSTSM
NSYSKMGHFTFNNTLEWTALHNFDMALSEEGYNLYNAVYAVAHTYHELILLQVESQQTEE
PKGTFTDCQQVSSTLKSRIFTNPVGELVNMKHRENQCADYDIFIIWNFPQGLGLKVKIGS
YLPCFPQSQQLHISEDLDWATGGSSVPSSLCSVTCTAGFRKIHQKQTADCCFDCDQCPEN
AVSNETADMEQCVRCPDDKYANLEKTHCLQRAVSFLAYEDPLGMALGCMALTFSALTVLV
LVTFVKYKDTPIVKANNRILSNILLISLVFCFLCPLLFIGHPNKATCILQQTTFGVFFTV
AISTVLAKTITVLMAFKLTSPGGKMRGMLASGAPNLVIPICTLVQLVLCGIWLVTSPPFI
DRDTQSEHGKTIIICNKGSVIAFHFVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTFS
MLVFCSVWITFLPVYHSTRGTVMVVVEVFSILASSAGLLGCIFVPKCFVILVRPDSNFLQ
KYKDKLFY
Download sequence
Identical sequences E9Q759
NP_001098095.1.92730 ENSMUSP00000128015 ENSMUSP00000128015 ENSMUSP00000128015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]