SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128106 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128106
Domain Number 1 Region: 52-503
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-109
Family L-arabinose binding protein-like 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128106
Domain Number - Region: 513-573,636-650
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00722
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128106   Gene: ENSMUSG00000090966   Transcript: ENSMUST00000164856
Sequence length 856
Comment pep:known chromosome:NCBIM37:17:23521770:23538831:1 gene:ENSMUSG00000090966 transcript:ENSMUST00000164856
Sequence
MFTLIFLFLFLNIPLLVADFISPRCFWKMKQNEYRDRHHGTGCIFLILAIQQPVKKEYFS
HILNIQTHTENHKYALALAFSIYEINRNPDLLPNMSLIFIFSADSCEWESELSLIRFGLQ
NSDNLPNYLCEELTKCILALTNMNWATTVTLHTILSNFLSDQLLHITYGTFHPALSDHEK
FPYLHQMASDHTSLALALVSFIIHFGWNWVGLVISDSDQGIQFLSYLRREMEKYTLCFAF
VNMIPLNINLYMSRAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITTS
QWDVSPSMKDFTFGNKYGTFAFEQHHSEISGFKHFVQTLNSVKCPDEYLVKLEWMHFNCE
VSASKCKTLKNCSSNHSLKWLMVHTFDMAFIEESYYIYNAVYAFAHVLHQFTFQKFDNLP
KDNGKEHNYSCKKLYSYLRKNHFINPVGDRVSMNQRDKLQEEYDIVYIWNFPQGLGLRVK
IGMFSPYFPNGQQVHLSEDMLKWARGSTQVPTSMCSADCGPGSRKFRMDGMAACCFHCKP
CPENEISNETNVDNCVQCPEDQYANTEQNHCIRKAVVFLSYEEPLGVALSLLSLCFSAFT
TVVLGIFVKHHNTPIVKANNRTLTYLLLISLIFCFLCPLLFIGHPNSATCILQQLTFGVV
FTVSLSTVLAKTITVVLAFKIIASQRMMKYFLISGAINYIIPICILIQVIVCAVWLRASP
PSVDIDAHSEHGQIIIVCHKGSVNAFYCVLGYLAILAFGSFTLAFLSRNLPGAFNEAKSI
TFSMLVFCSVWVTFIPVYHSTKGKVMVAVEIFSTLASSAGMLGCIFVPKCYTILFRQDQN
SLEMIRVKSSSNVHVS
Download sequence
Identical sequences E9Q6I0
ENSMUSP00000128106 ENSMUSP00000128106 ENSMUSP00000128106 NP_001098050.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]