SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128493 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128493
Domain Number 1 Region: 32-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.81e-123
Family L-arabinose binding protein-like 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128493
Domain Number - Region: 505-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000161
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128493   Gene: ENSMUSG00000090619   Transcript: ENSMUST00000166447
Sequence length 853
Comment pep:known chromosome:NCBIM37:7:49371841:49451146:1 gene:ENSMUSG00000090619 transcript:ENSMUST00000166447
Sequence
MFRIFTFVFLYFPIFMCAFTDNECYVKSNDYFYHEGDVTIGALFPLHILYTGNTLTDQSF
PYNFQDYHIQYKFKNYLFVLALVFAIEEINRNPDLLPNITIGYDIYNIPFTEKNILYSAF
LWRTGISHPLPNCDCGHKRTSPAVLTGPSWSASAHIGTFLQLYKIPQLTFGPFDSILNDR
AQFNSLYQMAPEDTSLPFAIVFLLLHFSWSWVGLILPDDHRGTQILSDLRENMESHGICI
AFLKMISGTWNAFSNALWKSMEKIEESSANVIVIYGDIISVQGLMLHITQLLVTWKVWVL
NSSWDVDSHSDYFMVESFHGSLIFSYHHEEMVEFMNFVQTVNPYKYPEDNYLPKFWHLFF
KCSFSKFDCQLLENCQPNASLDLLPRHLFDPAMSEEGYNIYNAVYAVAYSLHEMNLQQIQ
TQPYANGEEMAFSPWQLHPFLKNTIMKSHVRGDTVTHGGRNLDAQYDILNFWNFPSGLGL
KVKVGTYSLSAQHSLHFSICEQMIQWPIGFTKIPQSVCSESCRPGFRKAAQEGKAVCCFD
CIPCANNEISNETDMEQCVQCPESHYANSEKNHCLQKSVSFLAYEEPLGMALTIIALCFT
LLTAVVLVVFVKHRDTPIVKANNRTLSYILLLTLFISFLSSLLFIGQPNTTTCILQQTAV
GILFTVALSTVLAKAITVVIAFKATVPARMVRWLMVSRAPNFIIPICTLIQLIICGIWLV
TSPPFIDLDTHAEHGHIIIVCNMGSTVAFHTVLGYLCSLALGSYTMAFLSRNLPDTFNEA
KFLSFSMQIFFCVWITFLPVYHSTKGKVMVAMEVFCILASNIALLGLIFTPKCYIILLRP
EKNSYLGVRHKII
Download sequence
Identical sequences L7N2A1
ENSMUSP00000128493 ENSMUSP00000128493 ENSMUSP00000128493 NP_001098527.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]